SPRYD4 (NM_207344) Human Recombinant Protein

Spryd4 protein,

Recombinant protein of human SPRY domain containing 4 (SPRYD4)

Product Info Summary

SKU: PROTQ8WW59
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

SPRYD4 (NM_207344) Human Recombinant Protein

View all Spryd4 recombinant proteins

SKU/Catalog Number

PROTQ8WW59

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human SPRY domain containing 4 (SPRYD4)

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

SPRYD4 (NM_207344) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTQ8WW59)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

23.275kDa

Amino Acid Sequence

MALLFARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDTGVKYGLVGLEPTKVALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGVDDRSWVFTYAQRKWYTMLANEKAPVEGIGQPEKVGLLLEYEAQKLSLVDVSQVSVVHTLQTDFRGPVVPAFALWDGELLTHSGLEVPEGL

Validation Images & Assay Conditions

Gene/Protein Information For Spryd4 (Source: Uniprot.org, NCBI)

Gene Name

Spryd4

Full Name

SPRY domain-containing protein 4

Weight

23.275kDa

Alternative Names

DKFZp686N0877; SPRY domain containing 4; SPRY domain-containing protein 4

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on Spryd4, check out the Spryd4 Infographic

Spryd4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Spryd4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTQ8WW59

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used SPRYD4 (NM_207344) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For SPRYD4 (NM_207344) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for SPRYD4 (NM_207344) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTQ8WW59
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.