Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™

12-Lipoxygenase antibody

Boster Bio Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™ catalog # A02275-1. Tested in WB applications. This antibody reacts with Mouse, Rat.

Product Info Summary

SKU: A02275-1
Size: 100 μg/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™

View all 12-Lipoxygenase Antibodies

SKU/Catalog Number

A02275-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™ catalog # A02275-1. Tested in WB applications. This antibody reacts with Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02275-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase, different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02275-1 is reactive to ALOX12 in Mouse, Rat

Applications

A02275-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

80 kDa

Calculated molecular weight

75.694kDa

Background of 12-Lipoxygenase

ALOX12, Arachidonate 12-lipoxygenase, is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the ALOX12 gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12 (S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For ALOX12 (Source: Uniprot.org, NCBI)

Gene Name

ALOX12

Full Name

Arachidonate 12-lipoxygenase, 12S-type

Weight

75.694kDa

Superfamily

lipoxygenase family

Alternative Names

12(S)-lipoxygenase; 12-LOX; 12S-lipoxygenase; 12S-LOXarachidonate 12-lipoxygenase, 12S-type; arachidonate 12-lipoxygenase; EC 1.13.11; EC 1.13.11.31; LOG12; platelet 12-LOX; platelet-type 12-lipoxygenase; Platelet-type lipoxygenase 12 ALOX12 12-LOX, 12S-LOX, LOG12 arachidonate 12-lipoxygenase, 12S type polyunsaturated fatty acid lipoxygenase ALOX12|12S-lipoxygenase|Arachidonate 12-lipoxygenase, 12S-type|arachidonate (12S)-lipoxygenase|arachidonate (15S)-lipoxygenase|arachidonate 15-lipoxygenase,15S-type|linoleate 13S-lipoxygenase|lipoxin synthase 12-LO|platelet 12-LOX|platelet-type 12-lipoxygenase|platelet-type lipoxygenase 12

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ALOX12, check out the ALOX12 Infographic

ALOX12 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ALOX12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A02275-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™

Question

See attached the WB image, lot number and protocol we used for skin using anti-12 Lipoxygenase/ALOX12 antibody A02275-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-04-07

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-07

Question

I am looking for to test anti-12 Lipoxygenase/ALOX12 antibody A02275-1 on rat skin for research purposes, then I may be interested in using anti-12 Lipoxygenase/ALOX12 antibody A02275-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-02-10

Answer

The products we sell, including anti-12 Lipoxygenase/ALOX12 antibody A02275-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-02-10

Question

Is this A02275-1 anti-12 Lipoxygenase/ALOX12 antibody reactive to the isotypes of ALOX12?

Verified Customer

Verified customer

Asked: 2019-10-28

Answer

The immunogen of A02275-1 anti-12 Lipoxygenase/ALOX12 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-28

Question

Is A02275-1 antibody specific to the leukocyte type or the platelet type?

Verified customer

Asked: 2019-09-24

Answer

The Anti-12 Lipoxygenase/ALOX12 Antibody Picoband A02275-1 is specific to the platelet type according to https://www.uniprot.org/uniprot/P18054 , it's alternative name is "Platelet-type lipoxygenase 12".

Boster Scientific Support

Answered: 2019-09-24

Question

Is there a BSA free version of anti-12 Lipoxygenase/ALOX12 antibody A02275-1 available?

Verified Customer

Verified customer

Asked: 2018-01-31

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-12 Lipoxygenase/ALOX12 antibody A02275-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-01-31

Question

I was wanting to use your anti-12 Lipoxygenase/ALOX12 antibody for WB for rat skin on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat skin identification?

C. Taylor

Verified customer

Asked: 2016-06-10

Answer

It shows on the product datasheet, A02275-1 anti-12 Lipoxygenase/ALOX12 antibody has been validated for WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat skin in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-06-10

Size

Conjugation

Total: $370

SKU:A02275-1

In stock, 1 left.

Order within 33 hours and 12 minutes to receive by Thu Mar 21

Get A Quote
Eddy test
In stock
Order Product
A02275-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.