Product Info Summary
SKU: | A02275-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™
View all 12-Lipoxygenase Antibodies
SKU/Catalog Number
A02275-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™ catalog # A02275-1. Tested in WB applications. This antibody reacts with Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02275-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase, different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02275-1 is reactive to ALOX12 in Mouse, Rat
Applications
A02275-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
80 kDa
Calculated molecular weight
75.694kDa
Background of 12-Lipoxygenase
ALOX12, Arachidonate 12-lipoxygenase, is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the ALOX12 gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12 (S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse, Rat
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of 12 Lipoxygenase using anti-12 Lipoxygenase antibody (A02275-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
lane 1: rat spleen tissue lysates,
lane 2: mouse spleen tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-12 Lipoxygenase antigen affinity purified polyclonal antibody (Catalog # A02275-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for 12 Lipoxygenase at approximately 80KD. The expected band size for 12 Lipoxygenase is at 75-80KD.
Protein Target Info & Infographic
Gene/Protein Information For ALOX12 (Source: Uniprot.org, NCBI)
Gene Name
ALOX12
Full Name
Arachidonate 12-lipoxygenase, 12S-type
Weight
75.694kDa
Superfamily
lipoxygenase family
Alternative Names
12(S)-lipoxygenase; 12-LOX; 12S-lipoxygenase; 12S-LOXarachidonate 12-lipoxygenase, 12S-type; arachidonate 12-lipoxygenase; EC 1.13.11; EC 1.13.11.31; LOG12; platelet 12-LOX; platelet-type 12-lipoxygenase; Platelet-type lipoxygenase 12 ALOX12 12-LOX, 12S-LOX, LOG12 arachidonate 12-lipoxygenase, 12S type polyunsaturated fatty acid lipoxygenase ALOX12|12S-lipoxygenase|Arachidonate 12-lipoxygenase, 12S-type|arachidonate (12S)-lipoxygenase|arachidonate (15S)-lipoxygenase|arachidonate 15-lipoxygenase,15S-type|linoleate 13S-lipoxygenase|lipoxin synthase 12-LO|platelet 12-LOX|platelet-type 12-lipoxygenase|platelet-type lipoxygenase 12
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ALOX12, check out the ALOX12 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ALOX12: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™ (A02275-1)
Hello CJ!
No publications found for A02275-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™
Question
See attached the WB image, lot number and protocol we used for skin using anti-12 Lipoxygenase/ALOX12 antibody A02275-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2020-04-07
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2020-04-07
Question
I am looking for to test anti-12 Lipoxygenase/ALOX12 antibody A02275-1 on rat skin for research purposes, then I may be interested in using anti-12 Lipoxygenase/ALOX12 antibody A02275-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2020-02-10
Answer
The products we sell, including anti-12 Lipoxygenase/ALOX12 antibody A02275-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2020-02-10
Question
Is this A02275-1 anti-12 Lipoxygenase/ALOX12 antibody reactive to the isotypes of ALOX12?
Verified Customer
Verified customer
Asked: 2019-10-28
Answer
The immunogen of A02275-1 anti-12 Lipoxygenase/ALOX12 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-10-28
Question
Is A02275-1 antibody specific to the leukocyte type or the platelet type?
Verified customer
Asked: 2019-09-24
Answer
The Anti-12 Lipoxygenase/ALOX12 Antibody Picoband A02275-1 is specific to the platelet type according to https://www.uniprot.org/uniprot/P18054 , it's alternative name is "Platelet-type lipoxygenase 12".
Boster Scientific Support
Answered: 2019-09-24
Question
Is there a BSA free version of anti-12 Lipoxygenase/ALOX12 antibody A02275-1 available?
Verified Customer
Verified customer
Asked: 2018-01-31
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-12 Lipoxygenase/ALOX12 antibody A02275-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-01-31
Question
I was wanting to use your anti-12 Lipoxygenase/ALOX12 antibody for WB for rat skin on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat skin identification?
C. Taylor
Verified customer
Asked: 2016-06-10
Answer
It shows on the product datasheet, A02275-1 anti-12 Lipoxygenase/ALOX12 antibody has been validated for WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat skin in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-06-10