Anti-alpha 1d Adrenergic Receptor/ADRA1A Antibody Picoband™

Boster Bio Anti-alpha 1d Adrenergic Receptor/ADRA1A Antibody Picoband™ catalog # PB9752. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9752
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-alpha 1d Adrenergic Receptor/ADRA1A Antibody Picoband™

See all alpha-1A Adrenergic R/ADRA1A products

SKU/Catalog Number







Boster Bio Anti-alpha 1d Adrenergic Receptor/ADRA1A Antibody Picoband™ catalog # PB9752. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-alpha 1d Adrenergic Receptor/ADRA1A Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9752)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the C-terminus of human ADRA1A (335-373aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9752 is reactive to ADRA1A in Human, Mouse, Rat


PB9752 is guaranteed for WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For ADRA1A (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Alpha-1A adrenergic receptor




G-protein coupled receptor 1 family

Alternative Names

a-1A AdrenergicR; ADRA1A; ADRA1Cadrenergic, alpha-1A-, receptor variant 1; ADRA1L1; adrenergic, alpha -1A-, receptor; adrenergic, alpha-1A-, receptor variant 3; adrenergic, alpha-1A-, receptor variant 5; adrenergic, alpha-1A-, receptor variant 8; adrenergic, alpha-1A-, receptor; adrenergic, alpha-1C-, receptor; alpha-1A Adrenergic R; alpha-1A adrenergic receptor; alpha1A AdrenergicR; Alpha-1A adrenoceptor; Alpha-1A adrenoreceptor; ALPHA1AAR; Alpha-1C adrenergic receptor; Alpha-adrenergic receptor 1c; G protein coupled receptor ADRA1A ADRA1C, ADRA1L1, ALPHA1AAR adrenoceptor alpha 1A alpha-1A adrenergic receptor|G protein coupled receptor|alpha-1A adrenoceptor|alpha-1A adrenoreceptor|alpha-1C adrenergic receptor

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ADRA1A, check out the ADRA1A Infographic

ADRA1A infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ADRA1A: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9752

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-alpha 1d Adrenergic Receptor/ADRA1A Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-alpha 1d Adrenergic Receptor/ADRA1A Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-alpha 1d Adrenergic Receptor/ADRA1A Antibody Picoband™


I would like to ask if it is possible to do a dual staining experiment using your product PB9752 Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband antibody in mouse and rat tissue with staining of the endothelial layer.

Verified Customer

Verified customer

Asked: 2020-03-31


We only have a data on goat anti-VEGF receptor 1 that has been tested successfully with dual staining of both mouse and rat sample. However, we think that this antibody PB9752 Anti-CD41/Integrin alpha 2b/ITGA2B Antibody Picoband that you want to use will work as well.

Boster Scientific Support

Answered: 2020-03-31


We are currently using anti-alpha 1d Adrenergic Receptor/ADRA1A antibody PB9752 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on canine tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-10


The anti-alpha 1d Adrenergic Receptor/ADRA1A antibody (PB9752) has not been validated for cross reactivity specifically with canine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-10


Hi: I would like to know the concentration of this PB9752 antibody.

Verified Customer

Verified customer

Asked: 2018-08-21


The concentration of this PB9752 antibody is 0.5mg/ml

Boster Scientific Support

Answered: 2018-08-21


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.