Product Info Summary
SKU: | A05278-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-AKR1D1 Antibody Picoband™
SKU/Catalog Number
A05278-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-AKR1D1 Antibody Picoband™ catalog # A05278-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-AKR1D1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05278-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1D1, which shares 90.9% and 93.9% amino acid (aa) sequence identity with mouse and rat AKR1D1, respectively.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A05278-1 is reactive to AKR1D1 in Human, Mouse, Rat
Applications
A05278-1 is guaranteed for Flow Cytometry, WB Boster Guarantee
Observed Molecular Weight
37 kDa
Calculated molecular weight
37.377kDa
Background of AKR1D1
Human delta (4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta (4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta (4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Flow Cytometry(Fixed), 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of AKR1D1 using anti-AKR1D1 antibody (A05278-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human HepG2 whole cell lysates,
Lane 2: human CACO-2 whole cell lysates,
Lane 3: rat liver tissue lysates,
Lane 4: mouse liver tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AKR1D1 antigen affinity purified polyclonal antibody (Catalog # A05278-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for AKR1D1 at approximately 37 kDa. The expected band size for AKR1D1 is at 37 kDa.
Click image to see more details
Figure 2. Flow Cytometry analysis of HepG2 cells using anti-AKR1D1 antibody (A05278-1).
Overlay histogram showing HepG2 cells stained with A05278-1 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-AKR1D1 Antibody (A05278-1, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For AKR1D1 (Source: Uniprot.org, NCBI)
Gene Name
AKR1D1
Full Name
Aldo-keto reductase family 1 member D1
Weight
37.377kDa
Superfamily
aldo/keto reductase family
Alternative Names
3o5bred; Aldo-keto reductase family 1 member D1,3-oxo-5-beta-steroid 4-dehydrogenase; aldo-keto reductase family 1, member D1 (delta4-3-ketosteroid-5-beta-reductase); CBAS2; Delta(4)-3-oxosteroid 5-beta-reductase; EC 1.3.1.3; SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1) AKR1D1 3o5bred, CBAS2, SRD5B1 aldo-keto reductase family 1 member D1 aldo-keto reductase family 1 member D1|delta(4)-3-ketosteroid 5-beta-reductase|delta(4)-3-oxosteroid 5-beta-reductase|steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1)
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on AKR1D1, check out the AKR1D1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AKR1D1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-AKR1D1 Antibody Picoband™ (A05278-1)
Hello CJ!
No publications found for A05278-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-AKR1D1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-AKR1D1 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
6 Customer Q&As for Anti-AKR1D1 Antibody Picoband™
Question
Is this A05278-1 anti-AKR1D1 antibody reactive to the isotypes of AKR1D1?
Verified Customer
Verified customer
Asked: 2020-04-21
Answer
The immunogen of A05278-1 anti-AKR1D1 antibody is A synthetic peptide corresponding to a sequence of human AKR1D1(EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-21
Question
Is there a BSA free version of anti-AKR1D1 antibody A05278-1 available?
Verified Customer
Verified customer
Asked: 2020-03-17
Answer
We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-AKR1D1 antibody A05278-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2020-03-17
Question
Does anti-AKR1D1 antibody A05278-1 work on primate IHC-F with liver?
Verified Customer
Verified customer
Asked: 2019-12-19
Answer
Our lab technicians have not tested anti-AKR1D1 antibody A05278-1 on primate. You can run a BLAST between primate and the immunogen sequence of anti-AKR1D1 antibody A05278-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated primate samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in primate liver in IHC-F, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-12-19
Question
Can you help my question with product A05278-1, anti-AKR1D1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2019-06-04
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A05278-1 anti-AKR1D1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2019-06-04
Question
We are currently using anti-AKR1D1 antibody A05278-1 for mouse tissue, and we are well pleased with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?
K. Jackson
Verified customer
Asked: 2016-10-17
Answer
The anti-AKR1D1 antibody (A05278-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2016-10-17
Question
I see that the anti-AKR1D1 antibody A05278-1 works with WB, what is the protocol used to produce the result images on the product page?
A. Li
Verified customer
Asked: 2014-04-15
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2014-04-15