Anti-ALDH1B1 Antibody Picoband™

Boster Bio Anti-ALDH1B1 Antibody Picoband™ catalog # PB10037. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: PB10037
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC-P, ICC, WB

Product Name

Anti-ALDH1B1 Antibody Picoband™

See all Aldehyde dehydrogenase 5 products

SKU/Catalog Number







Boster Bio Anti-ALDH1B1 Antibody Picoband™ catalog # PB10037. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ALDH1B1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10037)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB10037 is reactive to ALDH1B1 in Human, Mouse, Rat


PB10037 is guaranteed for Flow Cytometry, IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For ALDH1B1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Aldehyde dehydrogenase X, mitochondrial




aldehyde dehydrogenase family

Alternative Names

aldehyde dehydrogenase 1 family, member B1; Aldehyde dehydrogenase 5; Aldehyde dehydrogenase family 1 member B1; ALDH class 2; ALDH5aldehyde dehydrogenase X, mitochondrial; ALDHXacetaldehyde dehydrogenase 5; EC 1.2.1; EC; MGC2230; mitochondrial aldehyde dehydrogenase X ALDH1B1 ALDH5, ALDHX aldehyde dehydrogenase 1 family member B1 aldehyde dehydrogenase X, mitochondrial|ALDH class 2|acetaldehyde dehydrogenase 5|aldehyde dehydrogenase 5|epididymis secretory sperm binding protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ALDH1B1, check out the ALDH1B1 Infographic

ALDH1B1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ALDH1B1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB10037 has been cited in 1 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Wang X, Yu Y, He Y, Cai Q, Gao S, Yao W, Liu Z, Tian Z, Han Q, Wang W, Sun R, Luo Y, Li C. Oncotarget. 2017 Dec 20;9(2):2502-2514. doi: 10.18632/oncotarget.23506. eCollection 2018 Jan 5. Upregulation of ALDH1B1 promotes tumor progression in osteos...

Have you used Anti-ALDH1B1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ALDH1B1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-ALDH1B1 Antibody Picoband™


Will anti-ALDH1B1 antibody PB10037 work for WB with eye?

Verified Customer

Verified customer

Asked: 2020-04-14


According to the expression profile of eye, ALDH1B1 is highly expressed in eye. So, it is likely that anti-ALDH1B1 antibody PB10037 will work for WB with eye.

Boster Scientific Support

Answered: 2020-04-14


We are currently using anti-ALDH1B1 antibody PB10037 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-11-22


The anti-ALDH1B1 antibody (PB10037) has not been tested for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-11-22


Would anti-ALDH1B1 antibody PB10037 work on dog WB with eye?

Verified Customer

Verified customer

Asked: 2019-10-17


Our lab technicians have not validated anti-ALDH1B1 antibody PB10037 on dog. You can run a BLAST between dog and the immunogen sequence of anti-ALDH1B1 antibody PB10037 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog eye in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-10-17


Do you have a BSA free version of anti-ALDH1B1 antibody PB10037 available?

Verified Customer

Verified customer

Asked: 2019-06-13


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-ALDH1B1 antibody PB10037 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-06-13


I am interested in to test anti-ALDH1B1 antibody PB10037 on mouse eye for research purposes, then I may be interested in using anti-ALDH1B1 antibody PB10037 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-05-21


The products we sell, including anti-ALDH1B1 antibody PB10037, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-21


Is a blocking peptide available for product anti-ALDH1B1 antibody (PB10037)?

Verified Customer

Verified customer

Asked: 2019-05-13


We do provide the blocking peptide for product anti-ALDH1B1 antibody (PB10037). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-05-13


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.