Anti-APLP1 Antibody Picoband®

APLP1 antibody

Boster Bio Anti-APLP1 Antibody Picoband® catalog # PB9476. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9476
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-APLP1 Antibody Picoband®

View all APLP1 Antibodies

SKU/Catalog Number

PB9476
PB0496 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-APLP1 Antibody Picoband® catalog # PB9476. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-APLP1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9476)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1, different from the related mouse sequence by three amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9476 is reactive to APLP1 in Human, Mouse, Rat

Observed Molecular Weight

85 kDa

Calculated molecular weight

72.2 kDa

Background of APLP1

Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein, whose gene is homologous to the APP gene, which has been shown to be involved in the pathogenesis of Alzheimer's disease. APLP1 is predominantly expressed in brain, particularly in the cerebral cortex postsynaptic density. The human gene has been mapped to chromosomal region 19q13.1. The gene is 11.8 kb long and contains 17 exons. APLP1 has been considered a candidate gene for CNF. All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients. No differences were observed between CNF patients and controls, suggesting that mutations in APLP1 are not involved in the etiology of CNF.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9476 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human
Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: Rat Brain Tissue, Rat Testis Tissue, SGC Whole Cell, 22RV1 Whole Cell, MCF-7 Whole Cell
IHC: Mouse Brain tissue, Rat Brain tissue
FCM: SiHa cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-APLP1 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-APLP1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-APLP1 Antibody Picoband®

Question

Is this PB9476 anti-APLP1 antibody reactive to the isotypes of APLP1?

Verified Customer

Verified customer

Asked: 2020-04-13

Answer

The immunogen of PB9476 anti-APLP1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82-112aa RRCLRDPQRVLEYCRQMYPELQIARVEQATQ), different from the related mouse sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-13

Question

We are currently using anti-APLP1 antibody PB9476 for mouse tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-04

Answer

The anti-APLP1 antibody (PB9476) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-04

Question

Is a blocking peptide available for product anti-APLP1 antibody (PB9476)?

Verified Customer

Verified customer

Asked: 2020-01-07

Answer

We do provide the blocking peptide for product anti-APLP1 antibody (PB9476). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2020-01-07

Question

I see that the anti-APLP1 antibody PB9476 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-05-03

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2019-05-03

Question

Please see the WB image, lot number and protocol we used for cerebrospinal fluid using anti-APLP1 antibody PB9476. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-11-21

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-11-21

Question

Will anti-APLP1 antibody PB9476 work on bovine Flow Cytometry with cerebrospinal fluid?

D. Jha

Verified customer

Asked: 2017-02-14

Answer

Our lab technicians have not tested anti-APLP1 antibody PB9476 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-APLP1 antibody PB9476 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine cerebrospinal fluid in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-02-14

Order DetailsPrice
PB9476

100μg

$370
PB9476-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9476-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9476-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9476-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9476-APC

100 μg APC conjugated (liquid)

$820
PB9476-FITC

100 μg FITC conjugated (liquid)

$570
PB9476-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9476-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9476-HRP

100 μg HRP conjugated (liquid)

$570
PB9476-PE

100 μg PE conjugated (liquid)

$820
PB9476-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9476
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Apr 10, 2026