Anti-APRT Antibody Picoband™

APRT antibody

Boster Bio Anti-APRT Antibody Picoband™ catalog # A02721. Tested in Flow Cytometry, IHC-F, ICC, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A02721
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IHC-F, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-APRT Antibody Picoband™

View all APRT Antibodies

SKU/Catalog Number

A02721

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-APRT Antibody Picoband™ catalog # A02721. Tested in Flow Cytometry, IHC-F, ICC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-APRT Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02721)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human APRT (5-49aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02721 is reactive to APRT in Human

Applications

A02721 is guaranteed for Flow Cytometry, IHC-F, ICC, WB Boster Guarantee

Background of APRT

Adenine phosphoribosyltransferase (APRTase) is an enzyme encoded by the APRT gene, found in humans on chromosome 16. It belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry, 0.5-1μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For APRT (Source: Uniprot.org, NCBI)

Uniprot ID

P07741

Gene ID

353

Gene Name

APRT

Full Name

Adenine phosphoribosyltransferase

Weight

19.608kDa

Superfamily

purine/pyrimidine phosphoribosyltransferase family

Alternative Names

adenine phosphoribosyltransferase; AMP diphosphorylase; AMP pyrophosphorylase; AMP; DKFZp686D13177; EC 2.4.2.7; MGC125856; MGC125857; MGC129961; transphosphoribosidase APRT AMPD, APRT adenine phosphoribosyltransferase adenine phosphoribosyltransferase|AMP diphosphorylase|AMP pyrophosphorylase|transphosphoribosidase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on APRT, check out the APRT Infographic

APRT infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for APRT: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for A02721

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-APRT Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-APRT Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-APRT Antibody Picoband™

Size

Conjugation

Total: $315

SKU:A02721

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A02721
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.