Anti-Arc Antibody Picoband™

Boster Bio Anti-Arc Antibody Picoband™ catalog # PB9753. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9753
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Arc Antibody Picoband™

See all ARC/ARG3.1 products

SKU/Catalog Number

PB9753

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Arc Antibody Picoband™ catalog # PB9753. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Arc Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9753)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9753 is reactive to ARC in Human, Mouse, Rat

Applications

PB9753 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For ARC (Source: Uniprot.Org, NCBI)

Uniprot ID

Q7LC44

Gene ID

23237

Gene Name

ARC

Full Name

Activity-regulated cytoskeleton-associated protein

Weight

45.316kDa

Superfamily

ARC/ARG3.1 family

Alternative Names

activity-regulated cytoskeleton-associated protein; ARC/ARG3.1; KIAA0278Arg3.1Activity-regulated gene 3.1 protein homolog ARC Arg3.1, hArc activity regulated cytoskeleton associated protein activity-regulated cytoskeleton-associated protein|ARC/ARG3.1|activity-regulated gene 3.1 protein homolog

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ARC, check out the ARC Infographic

ARC infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ARC: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9753

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Arc Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Arc Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Arc Antibody Picoband™

Question

We are currently using anti-Arc antibody PB9753 for mouse tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2019-12-27

Answer

The anti-Arc antibody (PB9753) has not been validated for cross reactivity specifically with primate tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-12-27

Question

We have observed staining in rat embl:baa19667.1}. What should we do? Is anti-Arc antibody supposed to stain embl:baa19667.1} positively?

Verified Customer

Verified customer

Asked: 2018-10-05

Answer

Based on literature embl:baa19667.1} does express ARC. Based on Uniprot.org, ARC is expressed in hypothalamus, forebrain eco:0000312, embl:aaf07185.1, brain eco:0000312, embl:baa19667.1, embl:aah75802.1} rc uterus eco:0000312, embl:aah12321.1, among other tissues. Regarding which tissues have ARC expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 9039502
Brain, and Uterus, Pubmed ID: 15489334
Forebrain, Pubmed ID: 10970730

Boster Scientific Support

Answered: 2018-10-05

Question

I am interested in using your anti-Arc antibody for vesicle-mediated intercellular transport studies. Has this antibody been tested with western blotting on hela whole cell lysate? We would like to see some validation images before ordering.

D. Jackson

Verified customer

Asked: 2017-08-25

Answer

I appreciate your inquiry. This PB9753 anti-Arc antibody is tested on rat brain tissue, tissue lysate, testis tissue, mouse brain, panc whole cell lysate, hela whole cell lysate. It is guaranteed to work for WB in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2017-08-25

Question

My team were happy with the WB result of your anti-Arc antibody. However we have seen positive staining in forebrain {eco:0000312 extracellular vesicle membrane using this antibody. Is that expected? Could you tell me where is ARC supposed to be expressed?

A. Li

Verified customer

Asked: 2013-12-09

Answer

Based on literature, forebrain eco:0000312 does express ARC. Generally ARC expresses in extracellular vesicle membrane. Regarding which tissues have ARC expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 9039502
Brain, and Uterus, Pubmed ID: 15489334
Forebrain, Pubmed ID: 10970730

Boster Scientific Support

Answered: 2013-12-09

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9753
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.