Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®

ASPH antibody

Boster Bio Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband® catalog # PB9478. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: PB9478
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®

View all ASPH Antibodies

SKU/Catalog Number

PB9478
PB0502 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband® catalog # PB9478. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9478)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH, identical to the related mouse sequence.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9478 is reactive to ASPH in Human, Mouse, Rat

Observed Molecular Weight

100 kDa

Calculated molecular weight

85.9 kDa

Background of ASPH

ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9478 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman
Immunocytochemistry0.5-1μg/mlHuman
Flow Cytometry (Fixed)1-3μg/1x106 cellsHuman

Tested application

Aspartate antibody was positively detected by WB in:
Rat Brain Tissue, Rat Liver Tissue, HELA Whole Cell, HEPG2 Whole Cell, HEPA Whole Cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Aspartate antibody was positively detected by IHC in:
Human Mammary Cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
Aspartate antibody was positively detected by ICC in:
A549 cell
Aspartate antibody was positively detected by FC in:
HeLa cell, U87 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Aspartate beta hydroxylase/ASPH Antibody Picoband®

Question

I was wanting to use your anti-Aspartate beta hydroxylase/ASPH antibody for ICC for mouse liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse liver identification?

Verified Customer

Verified customer

Asked: 2020-02-10

Answer

It shows on the product datasheet, PB9478 anti-Aspartate beta hydroxylase/ASPH antibody has been tested for Flow Cytometry, IHC-P, ICC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse liver in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-10

Question

We are currently using anti-Aspartate beta hydroxylase/ASPH antibody PB9478 for human tissue, and we are content with the IHC-P results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-13

Answer

The anti-Aspartate beta hydroxylase/ASPH antibody (PB9478) has not been tested for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-13

Question

I am looking for to test anti-Aspartate beta hydroxylase/ASPH antibody PB9478 on mouse liver for research purposes, then I may be interested in using anti-Aspartate beta hydroxylase/ASPH antibody PB9478 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-08-28

Answer

The products we sell, including anti-Aspartate beta hydroxylase/ASPH antibody PB9478, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-08-28

Question

Will anti-Aspartate beta hydroxylase/ASPH antibody PB9478 work for ICC with liver?

O. Carter

Verified customer

Asked: 2017-06-19

Answer

According to the expression profile of liver, ASPH is highly expressed in liver. So, it is likely that anti-Aspartate beta hydroxylase/ASPH antibody PB9478 will work for ICC with liver.

Boster Scientific Support

Answered: 2017-06-19

Question

Does PB9478 anti-Aspartate beta hydroxylase/ASPH antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

R. Kulkarni

Verified customer

Asked: 2016-02-11

Answer

As indicated on the product datasheet, PB9478 anti-Aspartate beta hydroxylase/ASPH antibody as been tested on ICC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2016-02-11

Question

See below the WB image, lot number and protocol we used for liver using anti-Aspartate beta hydroxylase/ASPH antibody PB9478. Please let me know if you require anything else.

F. Johnson

Verified customer

Asked: 2013-12-26

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2013-12-26

Question

Is this PB9478 anti-Aspartate beta hydroxylase/ASPH antibody reactive to the isotypes of ASPH?

A. Jha

Verified customer

Asked: 2013-03-19

Answer

The immunogen of PB9478 anti-Aspartate beta hydroxylase/ASPH antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2013-03-19

Order DetailsPrice
PB9478

100μg

$370
PB9478-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9478-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9478-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9478-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9478-APC

100 μg APC conjugated (liquid)

$820
PB9478-FITC

100 μg FITC conjugated (liquid)

$570
PB9478-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9478-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9478-HRP

100 μg HRP conjugated (liquid)

$570
PB9478-PE

100 μg PE conjugated (liquid)

$820
PB9478-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9478
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 14, 2026