Product Info Summary
SKU: | A01099 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ASXL1 Antibody Picoband™
SKU/Catalog Number
A01099
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ASXL1 Antibody Picoband™ catalog # A01099. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ASXL1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01099)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ASXL1, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A01099 is reactive to ASXL1 in Human, Mouse, Rat
Applications
A01099 is guaranteed for Flow Cytometry, WB Boster Guarantee
Observed Molecular Weight
165 kDa
Calculated molecular weight
165.432kDa
Background of ASXL1
Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Flow Cytometry, 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ASXL1 using anti-ASXL1 antibody (A01099).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human 293T whole cell lysates,
Lane 2: human MCF-7 whole cell lysates,
Lane 3: human CACO-2 whole cell lysates,
Lane 4: rat C6 whole cell lysates,
Lane 5: mouse NIH/3T3 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ASXL1 antigen affinity purified polyclonal antibody (Catalog # A01099) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ASXL1 at approximately 165 kDa. The expected band size for ASXL1 is at 165 kDa.
Click image to see more details
Figure 2. Flow Cytometry analysis of HepG2 cells using anti-ASXL1 antibody (A01099).
Overlay histogram showing HepG2 cells stained with A01099 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ASXL1 Antibody (A01099, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For ASXL1 (Source: Uniprot.org, NCBI)
Gene Name
ASXL1
Full Name
Polycomb group protein ASXL1
Weight
165.432kDa
Superfamily
Asx family
Alternative Names
additional sex combs like 1 (Drosophila) ASXL1 BOPS, MDS ASXL transcriptional regulator 1 polycomb group protein ASXL1|additional sex combs like 1, transcriptional regulator|additional sex combs like transcriptional regulator 1|putative Polycomb group protein ASXL1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ASXL1, check out the ASXL1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ASXL1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ASXL1 Antibody Picoband™ (A01099)
Hello CJ!
No publications found for A01099
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ASXL1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ASXL1 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-ASXL1 Antibody Picoband™
Question
Is this A01099 anti-ASXL1 antibody reactive to the isotypes of ASXL1?
A. Brown
Verified customer
Asked: 2020-03-12
Answer
The immunogen of A01099 anti-ASXL1 antibody is A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-12
Question
I have a question about product A01099, anti-ASXL1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
Verified Customer
Verified customer
Asked: 2020-01-28
Answer
We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01099 anti-ASXL1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2020-01-28
Question
I was wanting to use your anti-ASXL1 antibody for WB for human prostate on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human prostate identification?
Verified Customer
Verified customer
Asked: 2019-07-09
Answer
It shows on the product datasheet, A01099 anti-ASXL1 antibody has been validated for Flow Cytometry, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human prostate in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-07-09
Question
Would A01099 anti-ASXL1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
F. Miller
Verified customer
Asked: 2016-12-06
Answer
You can see on the product datasheet, A01099 anti-ASXL1 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2016-12-06