Anti-CD229/LY9 Antibody

LY9 antibody

Boster Bio Anti-CD229/LY9 Antibody catalog # A05830-1. Tested in Flow Cytometry, IHC, ICC applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A05830-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC

Customers Who Bought This Also Bought

Product Name

Anti-CD229/LY9 Antibody

View all LY9 Antibodies

SKU/Catalog Number

A05830-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CD229/LY9 Antibody catalog # A05830-1. Tested in Flow Cytometry, IHC, ICC applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD229/LY9 Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05830-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human CD229/LY9, which shares 55.9% and 61.8% amino acid (aa) sequence identity with mouse and rat CD229/LY9, respectively.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A05830-1 is reactive to LY9 in Human, Mouse, Rat

Calculated molecular weight

72.1 kDa

Background of LY9

T-lymphocyte surface antigen Ly-9 is a protein that in humans is encoded by the LY9 gene. This gene is mapped to 17q21.31. LY9 has also recently been designated CD229 (cluster of differentiation 229). LY9 belongs to the SLAM family of immunomodulatory receptors and interacts with the adaptor molecule SAP.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A05830-1 is guaranteed for Flow Cytometry, IHC, ICC Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/ml
Immunohistochemistry (Frozen Section)0.5-1μg/ml
Immunocytochemistry0.5-1μg/ml
Flow Cytometry (Fixed)1-3μg/1x106 cells

Note: For flow cytometry (FCM), validated for fixed cells only. Not validated for FACS or surface flow cytometry using live cells.

Tested application

CD229 antibody was positively detected by IHC in:
mouse spleen tissue, mouse spleen tissue, rat spleen tissue, rat spleen tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
CD229 antibody was positively detected by FC in:
Jurkat cell, Daudi cell, U937 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-CD229/LY9 Antibody?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-CD229/LY9 Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-CD229/LY9 Antibody

Question

Will anti-CD229/LY9 antibody A05830-1 work on dog Flow Cytometry with leukemic t-cell?

Verified Customer

Verified customer

Asked: 2020-01-01

Answer

Our lab technicians have not validated anti-CD229/LY9 antibody A05830-1 on dog. You can run a BLAST between dog and the immunogen sequence of anti-CD229/LY9 antibody A05830-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated dog samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in dog leukemic t-cell in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-01-01

Question

Is this A05830-1 anti-CD229/LY9 antibody reactive to the isotypes of LY9?

B. Evans

Verified customer

Asked: 2019-08-27

Answer

The immunogen of A05830-1 anti-CD229/LY9 antibody is A synthetic peptide corresponding to a sequence of human CD229/LY9 (YKAQINQRNFEVTTEEEFTLFVYEQLQEPQVTMK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-27

Question

We are currently using anti-CD229/LY9 antibody A05830-1 for rat tissue, and we are happy with the ICC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-14

Answer

The anti-CD229/LY9 antibody (A05830-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-14

Question

you antibody to test anti-CD229/LY9 antibody A05830-1 on mouse leukemia for research purposes, then I may be interested in using anti-CD229/LY9 antibody A05830-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-06-21

Answer

The products we sell, including anti-CD229/LY9 antibody A05830-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-06-21

Order DetailsPrice
A05830-1

100μg

$370
A05830-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A05830-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A05830-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A05830-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A05830-1-APC

100 μg APC conjugated (liquid)

$820
A05830-1-FITC

100 μg FITC conjugated (liquid)

$570
A05830-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A05830-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A05830-1-HRP

100 μg HRP conjugated (liquid)

$570
A05830-1-PE

100 μg PE conjugated (liquid)

$820
A05830-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A05830-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 26, 2026