Anti-CD272/BTLA Antibody Picoband™

Boster Bio Anti-CD272/BTLA Antibody Picoband™ catalog # A03149. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse.

Product Info Summary

SKU: A03149
Size: 100μg/vial
Reactive Species: Human, Mouse
Host: Rabbit
Application: Flow Cytometry, IHC-P, IHC-F, ICC, WB

Product Name

Anti-CD272/BTLA Antibody Picoband™

See all BTLA/CD272 products

SKU/Catalog Number

A03149

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CD272/BTLA Antibody Picoband™ catalog # A03149. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD272/BTLA Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03149)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A03149 is reactive to BTLA in Human, Mouse

Applications

A03149 is guaranteed for Flow Cytometry, IHC-P, IHC-F, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For BTLA (Source: Uniprot.Org, NCBI)

Uniprot ID

Q7Z6A9

Gene ID

151888

Gene Name

BTLA

Full Name

B- and T-lymphocyte attenuator

Weight

32.834kDa

Alternative Names

B and T lymphocyte associated; B and T lymphocyte attenuator; B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; BTLA; BTLA1; CD272 antigen; CD272; FLJ16065; MGC129743 BTLA BTLA1, CD272 B and T lymphocyte associated B- and T-lymphocyte attenuator|B- and T-lymphocyte-associated protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on BTLA, check out the BTLA Infographic

BTLA infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for BTLA: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A03149

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-CD272/BTLA Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-CD272/BTLA Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-CD272/BTLA Antibody Picoband™

Question

Our lab were content with the WB result of your anti-CD272/BTLA antibody . However we have seen positive staining in trachea cell membrane using this antibody. Is that expected? Could you tell me where is BTLA supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-04-02

Answer

Based on literature, trachea does express BTLA. Generally BTLA expresses in cell membrane. Regarding which tissues have BTLA expression, here are a few articles citing expression in various tissues:
Peripheral blood, Pubmed ID: 16641997
Trachea, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2020-04-02

Question

Is this A03149 anti-CD272/BTLA antibody reactive to the isotypes of BTLA?

Verified Customer

Verified customer

Asked: 2020-04-01

Answer

The immunogen of A03149 anti-CD272/BTLA antibody is A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-01

Question

I was wanting to use your anti-CD272/BTLA antibody for IHC-F for mouse peripheral blood on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse peripheral blood identification?

Verified Customer

Verified customer

Asked: 2020-02-14

Answer

As indicated on the product datasheet, A03149 anti-CD272/BTLA antibody has been tested for Flow Cytometry, IHC-P, IHC-F, ICC, WB on human, mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse peripheral blood in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-14

Question

See attached the WB image, lot number and protocol we used for peripheral blood using anti-CD272/BTLA antibody A03149. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-01-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-28

Question

We have observed staining in human leukocyte. Any tips? Is anti-CD272/BTLA antibody supposed to stain leukocyte positively?

Verified Customer

Verified customer

Asked: 2019-12-12

Answer

Based on literature leukocyte does express BTLA. Based on Uniprot.org, BTLA is expressed in leukocyte, peripheral blood, trachea, among other tissues. Regarding which tissues have BTLA expression, here are a few articles citing expression in various tissues:
Peripheral blood, Pubmed ID: 16641997
Trachea, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-12-12

Question

Our lab used your anti-CD272/BTLA antibody for WB on trachea in a previous project. I am using mouse, and We are going to use the antibody for ICC next. Our lab want to know about examining trachea as well as leukocyte in our next experiment. Could you please give me some suggestion on which antibody would work the best for ICC?

Verified Customer

Verified customer

Asked: 2019-12-03

Answer

I have checked the website and datasheets of our anti-CD272/BTLA antibody and I see that A03149 has been tested on mouse in both WB and ICC. Thus A03149 should work for your application. Our Boster satisfaction guarantee will cover this product for ICC in mouse even if the specific tissue type has not been validated. We do have a comprehensive range of products for ICC detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-12-03

Question

We are currently using anti-CD272/BTLA antibody A03149 for mouse tissue, and we are content with the IHC-F results. The species of reactivity given in the datasheet says human, mouse. Is it likely that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2019-11-18

Answer

The anti-CD272/BTLA antibody (A03149) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-11-18

Question

We need using your anti-CD272/BTLA antibody for immune response-regulating cell surface receptor signaling pathway studies. Has this antibody been tested with western blotting on human hek293 whole cell lysate? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2019-11-15

Answer

We appreciate your inquiry. This A03149 anti-CD272/BTLA antibody is validated on human hek293 whole cell lysate, jurkat whole cell lysate, mouse thymus tissue, tissue lysate. It is guaranteed to work for Flow Cytometry, IHC-P, IHC-F, ICC, WB in human, mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2019-11-15

Question

Do you have a BSA free version of anti-CD272/BTLA antibody A03149 available?

Verified Customer

Verified customer

Asked: 2019-10-31

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-CD272/BTLA antibody A03149 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-10-31

Question

Does A03149 anti-CD272/BTLA antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-09-20

Answer

It shows on the product datasheet, A03149 anti-CD272/BTLA antibody as been validated on IHC-F. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-09-20

Question

I see that the anti-CD272/BTLA antibody A03149 works with IHC-F, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-08-13

Answer

You can find protocols for IHC-F on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-08-13

Question

Is a blocking peptide available for product anti-CD272/BTLA antibody (A03149)?

Verified Customer

Verified customer

Asked: 2019-07-15

Answer

We do provide the blocking peptide for product anti-CD272/BTLA antibody (A03149). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-07-15

Question

Does anti-CD272/BTLA antibody A03149 work for IHC-F with peripheral blood?

Verified Customer

Verified customer

Asked: 2018-12-19

Answer

According to the expression profile of peripheral blood, BTLA is highly expressed in peripheral blood. So, it is likely that anti-CD272/BTLA antibody A03149 will work for IHC-F with peripheral blood.

Boster Scientific Support

Answered: 2018-12-19

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for peripheral blood using anti-CD272/BTLA antibody A03149. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-08-06

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-08-06

Question

Can you help my question with product A03149, anti-CD272/BTLA antibody . I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2017-11-10

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03149 anti-CD272/BTLA antibody , we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-11-10

Question

I am interested in to test anti-CD272/BTLA antibody A03149 on mouse peripheral blood for research purposes, then I may be interested in using anti-CD272/BTLA antibody A03149 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

C. Zhang

Verified customer

Asked: 2015-11-10

Answer

The products we sell, including anti-CD272/BTLA antibody A03149, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2015-11-10

Conjugation

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A03149
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.