Anti-CD46 Antibody Picoband®

Cd46 antibody

Boster Bio Anti-CD46 Antibody Picoband® catalog # PB9848. Tested in WB applications. This antibody reacts with Mouse. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9848
Size: 100 μg/vial
Reactive Species: Mouse
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-CD46 Antibody Picoband®

View all Cd46 Antibodies

SKU/Catalog Number

PB9848
PB0894 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CD46 Antibody Picoband® catalog # PB9848. Tested in WB applications. This antibody reacts with Mouse. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD46 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9848)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46, different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9848 is reactive to Cd46 in Mouse

Observed Molecular Weight

41 kDa, 70 kDa

Calculated molecular weight

40.9 kDa

Background of Cd46

CD46 complement regulatory protein, also known as CD46 (cluster of differentiation 46) and Membrane Cofactor Protein, is a protein which in humans is encoded by the CD46 gene. The protein encoded by this gene is a type I membrane protein and is a regulatory part of the complement system. And the encoded protein has cofactor activity for inactivation of complement components C3b and C4b by serum factor I, which protects the host cell from damage by complement. In addition, the encoded protein can act as a receptor for the Edmonston strain of measles virus, human herpesvirus-6, and type IV pili of pathogenic Neisseria. Finally, the protein encoded by this gene may be involved in the fusion of the spermatozoa with the oocyte during fertilization. Mutations at this locus have been associated with susceptibility to hemolytic uremic syndrome. Alternatively spliced transcript variants encoding different isoforms have been described. 

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9848 is guaranteed for WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlMouse

Tested application

CD46 antibody was positively detected by WB in:
mouse testis tissue, NIH/3T3 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-CD46 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-CD46 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-CD46 Antibody Picoband®

Question

See attached the WB image, lot number and protocol we used for palpebral conjunctiva using anti-CD46 antibody PB9848. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-01-31

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-31

Question

I was wanting to use to test anti-CD46 antibody PB9848 on mouse palpebral conjunctiva for research purposes, then I may be interested in using anti-CD46 antibody PB9848 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

L. Wu

Verified customer

Asked: 2020-01-28

Answer

The products we sell, including anti-CD46 antibody PB9848, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-01-28

Question

I see that the anti-CD46 antibody PB9848 works with WB, what is the protocol used to produce the result images on the product page?

C. Collins

Verified customer

Asked: 2019-10-30

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2019-10-30

Question

Is this PB9848 anti-CD46 antibody reactive to the isotypes of CD46?

Verified Customer

Verified customer

Asked: 2019-10-16

Answer

The immunogen of PB9848 anti-CD46 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-16

Question

Is a blocking peptide available for product anti-CD46 antibody (PB9848)?

Verified Customer

Verified customer

Asked: 2019-09-11

Answer

We do provide the blocking peptide for product anti-CD46 antibody (PB9848). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-09-11

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for palpebral conjunctiva using anti-CD46 antibody PB9848. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-08-13

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-13

Question

Is there a BSA free version of anti-CD46 antibody PB9848 available?

Verified Customer

Verified customer

Asked: 2019-07-29

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CD46 antibody PB9848 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-07-29

Question

Does anti-CD46 antibody PB9848 work for WB with palpebral conjunctiva?

Verified Customer

Verified customer

Asked: 2019-06-25

Answer

According to the expression profile of palpebral conjunctiva, CD46 is highly expressed in palpebral conjunctiva. So, it is likely that anti-CD46 antibody PB9848 will work for WB with palpebral conjunctiva.

Boster Scientific Support

Answered: 2019-06-25

Question

We have seen staining in mouse sperm. Any tips? Is anti-CD46 antibody supposed to stain sperm positively?

Verified Customer

Verified customer

Asked: 2019-06-17

Answer

According to literature sperm does express CD46. According to Uniprot.org, CD46 is expressed in palpebral conjunctiva, testis, teratocarcinoma, fetal kidney, liver salivary gland, liver, sperm, among other tissues. Regarding which tissues have CD46 expression, here are a few articles citing expression in various tissues:
Fetal kidney, Liver, and Salivary gland, Pubmed ID: 17974005
Liver, Pubmed ID: 16710414, 24275569
Sperm, Pubmed ID: 1479546
Teratocarcinoma, Pubmed ID: 14702039
Testis, Pubmed ID: 8418811, 9659228, 15489334

Boster Scientific Support

Answered: 2019-06-17

Question

I have a question about product PB9848, anti-CD46 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-03-22

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9848 anti-CD46 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-03-22

Question

I was wanting to use your anti-CD46 antibody for WB for mouse palpebral conjunctiva on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse palpebral conjunctiva identification?

F. Parker

Verified customer

Asked: 2018-02-08

Answer

It shows on the product datasheet, PB9848 anti-CD46 antibody has been validated for WB on mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse palpebral conjunctiva in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-02-08

Question

We are currently using anti-CD46 antibody PB9848 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says mouse. Is it possible that the antibody can work on canine tissues as well?

M. Collins

Verified customer

Asked: 2018-01-22

Answer

The anti-CD46 antibody (PB9848) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-01-22

Question

Will PB9848 anti-CD46 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

M. Miller

Verified customer

Asked: 2015-11-12

Answer

It shows on the product datasheet, PB9848 anti-CD46 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2015-11-12

Question

My lab would like using your anti-CD46 antibody for positive regulation of regulatory t cell differentiation studies. Has this antibody been tested with western blotting on nih3t3 whole cell lysates? We would like to see some validation images before ordering.

M. Baker

Verified customer

Asked: 2015-04-15

Answer

We appreciate your inquiry. This PB9848 anti-CD46 antibody is validated on nih3t3 whole cell lysates. It is guaranteed to work for WB in mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2015-04-15

Question

Does anti-CD46 antibody PB9848 work on bovine WB with liver salivary gland?

A. Parker

Verified customer

Asked: 2014-06-12

Answer

Our lab technicians have not tested anti-CD46 antibody PB9848 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-CD46 antibody PB9848 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine liver salivary gland in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-06-12

Question

My team were content with the WB result of your anti-CD46 antibody. However we have been able to see positive staining in teratocarcinoma secretory vesicle, using this antibody. Is that expected? Could you tell me where is CD46 supposed to be expressed?

H. Parker

Verified customer

Asked: 2013-09-03

Answer

From what I have seen in literature, teratocarcinoma does express CD46. Generally CD46 expresses in cytoplasmic vesicle, secretory vesicle,. Regarding which tissues have CD46 expression, here are a few articles citing expression in various tissues:
Fetal kidney, Liver, and Salivary gland, Pubmed ID: 17974005
Liver, Pubmed ID: 16710414, 24275569
Sperm, Pubmed ID: 1479546
Teratocarcinoma, Pubmed ID: 14702039
Testis, Pubmed ID: 8418811, 9659228, 15489334

Boster Scientific Support

Answered: 2013-09-03

Order DetailsPrice
PB9848

100μg

$370
PB9848-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9848-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9848-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9848-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9848-APC

100 μg APC conjugated (liquid)

$820
PB9848-FITC

100 μg FITC conjugated (liquid)

$570
PB9848-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9848-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9848-HRP

100 μg HRP conjugated (liquid)

$570
PB9848-PE

100 μg PE conjugated (liquid)

$820
PB9848-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9848
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 19, 2026