Anti-CD46 Antibody Picoband™

Boster Bio Anti-CD46 Antibody Picoband™ catalog # PB9848. Tested in WB applications. This antibody reacts with Mouse.

Product Info Summary

SKU: PB9848
Size: 100μg/vial
Reactive Species: Mouse
Host: Rabbit
Application: WB

Product Name

Anti-CD46 Antibody Picoband™

See all Cd46 products

SKU/Catalog Number







Boster Bio Anti-CD46 Antibody Picoband™ catalog # PB9848. Tested in WB applications. This antibody reacts with Mouse.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CD46 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9848)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9848 is reactive to Cd46 in Mouse


PB9848 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse

Validation Images & Assay Conditions

Gene/Protein Information For Cd46 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Membrane cofactor protein



Alternative Names

AHUS2; CD46 antigen; CD46 molecule, complement regulatory protein; CD46; MCP; membrane cofactor protein (CD46, trophoblast-lymphocyte cross-reactive antigen); MIC10; TLXcomplement regulatory protein; trophoblast leucocyte common antigen; Trophoblast leukocyte common antigen; trophoblast-lymphocyte cross-reactive antigen Cd46|Mc, Mcp|CD46 antigen, complement regulatory protein|membrane cofactor protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on Cd46, check out the Cd46 Infographic

Cd46 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for Cd46: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9848

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-CD46 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-CD46 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-CD46 Antibody Picoband™


See attached the WB image, lot number and protocol we used for palpebral conjunctiva using anti-CD46 antibody PB9848. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-01-31


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-31


I was wanting to use to test anti-CD46 antibody PB9848 on mouse palpebral conjunctiva for research purposes, then I may be interested in using anti-CD46 antibody PB9848 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

L. Wu

Verified customer

Asked: 2020-01-28


The products we sell, including anti-CD46 antibody PB9848, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-01-28


I see that the anti-CD46 antibody PB9848 works with WB, what is the protocol used to produce the result images on the product page?

C. Collins

Verified customer

Asked: 2019-10-30


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-10-30


Is this PB9848 anti-CD46 antibody reactive to the isotypes of CD46?

Verified Customer

Verified customer

Asked: 2019-10-16


The immunogen of PB9848 anti-CD46 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK), different from the related human sequence by twelve amino acids, and from the related rat sequence by nine amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-16


Is a blocking peptide available for product anti-CD46 antibody (PB9848)?

Verified Customer

Verified customer

Asked: 2019-09-11


We do provide the blocking peptide for product anti-CD46 antibody (PB9848). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-09-11


I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for palpebral conjunctiva using anti-CD46 antibody PB9848. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-08-13


Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-13


Is there a BSA free version of anti-CD46 antibody PB9848 available?

Verified Customer

Verified customer

Asked: 2019-07-29


We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-CD46 antibody PB9848 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-07-29


Does anti-CD46 antibody PB9848 work for WB with palpebral conjunctiva?

Verified Customer

Verified customer

Asked: 2019-06-25


According to the expression profile of palpebral conjunctiva, CD46 is highly expressed in palpebral conjunctiva. So, it is likely that anti-CD46 antibody PB9848 will work for WB with palpebral conjunctiva.

Boster Scientific Support

Answered: 2019-06-25


We have seen staining in mouse sperm. Any tips? Is anti-CD46 antibody supposed to stain sperm positively?

Verified Customer

Verified customer

Asked: 2019-06-17


According to literature sperm does express CD46. According to, CD46 is expressed in palpebral conjunctiva, testis, teratocarcinoma, fetal kidney, liver salivary gland, liver, sperm, among other tissues. Regarding which tissues have CD46 expression, here are a few articles citing expression in various tissues:
Fetal kidney, Liver, and Salivary gland, Pubmed ID: 17974005
Liver, Pubmed ID: 16710414, 24275569
Sperm, Pubmed ID: 1479546
Teratocarcinoma, Pubmed ID: 14702039
Testis, Pubmed ID: 8418811, 9659228, 15489334

Boster Scientific Support

Answered: 2019-06-17


I have a question about product PB9848, anti-CD46 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-03-22


We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9848 anti-CD46 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-03-22


I was wanting to use your anti-CD46 antibody for WB for mouse palpebral conjunctiva on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse palpebral conjunctiva identification?

F. Parker

Verified customer

Asked: 2018-02-08


It shows on the product datasheet, PB9848 anti-CD46 antibody has been validated for WB on mouse tissues. We have an innovator award program that if you test this antibody and show it works in mouse palpebral conjunctiva in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-02-08


We are currently using anti-CD46 antibody PB9848 for mouse tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says mouse. Is it possible that the antibody can work on canine tissues as well?

M. Collins

Verified customer

Asked: 2018-01-22


The anti-CD46 antibody (PB9848) has not been tested for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-01-22


Will PB9848 anti-CD46 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

M. Miller

Verified customer

Asked: 2015-11-12


It shows on the product datasheet, PB9848 anti-CD46 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2015-11-12


My lab would like using your anti-CD46 antibody for positive regulation of regulatory t cell differentiation studies. Has this antibody been tested with western blotting on nih3t3 whole cell lysates? We would like to see some validation images before ordering.

M. Baker

Verified customer

Asked: 2015-04-15


We appreciate your inquiry. This PB9848 anti-CD46 antibody is validated on nih3t3 whole cell lysates. It is guaranteed to work for WB in mouse. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2015-04-15


Does anti-CD46 antibody PB9848 work on bovine WB with liver salivary gland?

A. Parker

Verified customer

Asked: 2014-06-12


Our lab technicians have not tested anti-CD46 antibody PB9848 on bovine. You can run a BLAST between bovine and the immunogen sequence of anti-CD46 antibody PB9848 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated bovine samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in bovine liver salivary gland in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-06-12


My team were content with the WB result of your anti-CD46 antibody. However we have been able to see positive staining in teratocarcinoma secretory vesicle, using this antibody. Is that expected? Could you tell me where is CD46 supposed to be expressed?

H. Parker

Verified customer

Asked: 2013-09-03


From what I have seen in literature, teratocarcinoma does express CD46. Generally CD46 expresses in cytoplasmic vesicle, secretory vesicle,. Regarding which tissues have CD46 expression, here are a few articles citing expression in various tissues:
Fetal kidney, Liver, and Salivary gland, Pubmed ID: 17974005
Liver, Pubmed ID: 16710414, 24275569
Sperm, Pubmed ID: 1479546
Teratocarcinoma, Pubmed ID: 14702039
Testis, Pubmed ID: 8418811, 9659228, 15489334

Boster Scientific Support

Answered: 2013-09-03


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.