Anti-Cdk6 Antibody Picoband™

Boster Bio Anti-Cdk6 Antibody Picoband™ catalog # PB9995. Tested in IHC, WB applications. This antibody reacts with Human, Rat. Cited in 4 publication(s).

Product Info Summary

SKU: PB9995
Size: 100μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Cdk6 Antibody Picoband™

See all CDK6 products

SKU/Catalog Number

PB9995

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Cdk6 Antibody Picoband™ catalog # PB9995. Tested in IHC, WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Cdk6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9995)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6 (119-150aa TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN), identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9995 is reactive to CDK6 in Human, Rat

Applications

PB9995 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat

Validation Images & Assay Conditions

Gene/Protein Information For CDK6 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q00534

Gene ID

1021

Gene Name

CDK6

Full Name

Cyclin-dependent kinase 6

Weight

36.938kDa

Superfamily

protein kinase superfamily

Alternative Names

Cell division protein kinase 6; cyclin-dependent kinase 6; EC 2.7.11; EC 2.7.11.22; PLSTIREMGC59692; Serine/threonine-protein kinase PLSTIRE CDK6 MCPH12, PLSTIRE cyclin dependent kinase 6 cyclin-dependent kinase 6|cell division protein kinase 6|serine/threonine-protein kinase PLSTIRE

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on CDK6, check out the CDK6 Infographic

CDK6 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for CDK6: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

PB9995 has been cited in 4 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Sun D,Zhao T,Long K,Wu M,Zhang Z.Triclosan down-regulates fatty acid synthase through microRNAs in HepG2 cells.Eur J Pharmacol .2021 Jun 15:174261.doi:10.1016/j.ejphar.2021.174261.Epub ahead of print.PMID:34144025.
Species: Human
PB9995 usage in article: APP:WB, SAMPLE:HEPG2 CELL, DILUTION:1:400

Long noncoding RNA NEAT1 promotes laryngeal squamous cell cancer through regulating miR-107/CDK6 pathway

Li P, Chen H, Chen S, Mo X, Li T, Xiao B, Yu R, Guo J. Br J Cancer. 2017 Feb 28;116(5):626-633. doi: 10.1038/bjc.2016.451. Epub 2017 Jan 12 Circular RNA 0000096 affects cell growth and migration in gastric cancer

Zhou R, Lu Z, Liu K, Guo J, Liu J, Zhou Y, Yang J, Mi M, Xu H. Curr Cancer Drug Targets. 2015;14(9):860-71. Platycodin D Induces Tumor Growth Arrest By Activating Foxo3A Expression In Prostate Cancer In Vitro And In Vivo.

Have you used Anti-Cdk6 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Cdk6 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-Cdk6 Antibody Picoband™

Question

I see that the anti-Cdk6 antibody PB9995 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-04-02

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-04-02

Question

We have been able to see staining in rat leukemic t-cell. Are there any suggestions? Is anti-Cdk6 antibody supposed to stain leukemic t-cell positively?

Verified Customer

Verified customer

Asked: 2020-02-24

Answer

From what I have seen in literature leukemic t-cell does express CDK6. From what I have seen in Uniprot.org, CDK6 is expressed in adrenal tissue, tongue, brain, leukemic t-cell, among other tissues. Regarding which tissues have CDK6 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Tongue, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2020-02-24

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukemic t-cell using anti-Cdk6 antibody PB9995. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-12-06

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-12-06

Question

We are currently using anti-Cdk6 antibody PB9995 for human tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it likely that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2019-07-19

Answer

The anti-Cdk6 antibody (PB9995) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-19

Question

Is this PB9995 anti-Cdk6 antibody reactive to the isotypes of CDK6?

N. Wu

Verified customer

Asked: 2019-07-17

Answer

The immunogen of PB9995 anti-Cdk6 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Cdk6 (119-150aa TETIKDMMFQLLRGLDFLHSHRVVHRDLKPQN), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-07-17

Question

My colleagues were content with the WB result of your anti-Cdk6 antibody. However we have seen positive staining in tongue cytoplasm. nucleus. cell projection using this antibody. Is that expected? Could you tell me where is CDK6 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-07-11

Answer

From what I have seen in literature, tongue does express CDK6. Generally CDK6 expresses in cytoplasm. nucleus. cell projection, ruffle. Regarding which tissues have CDK6 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Leukemic T-cell, Pubmed ID: 19690332
Tongue, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-07-11

Question

Would PB9995 anti-Cdk6 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

R. Miller

Verified customer

Asked: 2019-07-09

Answer

You can see on the product datasheet, PB9995 anti-Cdk6 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-07-09

Question

I was wanting to use your anti-Cdk6 antibody for WB for rat leukemic t-cell on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for rat leukemic t-cell identification?

S. Carter

Verified customer

Asked: 2019-04-18

Answer

As indicated on the product datasheet, PB9995 anti-Cdk6 antibody has been tested for IHC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat leukemic t-cell in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-04-18

Question

I have a question about product PB9995, anti-Cdk6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

M. Jones

Verified customer

Asked: 2018-10-24

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9995 anti-Cdk6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-10-24

Question

Please see the WB image, lot number and protocol we used for leukemic t-cell using anti-Cdk6 antibody PB9995. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-09-11

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-09-11

Question

you antibody to test anti-Cdk6 antibody PB9995 on rat leukemic t-cell for research purposes, then I may be interested in using anti-Cdk6 antibody PB9995 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2018-03-20

Answer

The products we sell, including anti-Cdk6 antibody PB9995, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-03-20

Question

We bought anti-Cdk6 antibody for IHC on leukemic t-cell in a previous experiment. I am using human, and I plan to use the antibody for WB next. Our lab want to know about examining leukemic t-cell as well as brain in our next experiment. Do you have any suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2018-03-12

Answer

I looked at the website and datasheets of our anti-Cdk6 antibody and I see that PB9995 has been validated on human in both IHC and WB. Thus PB9995 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2018-03-12

Question

Is a blocking peptide available for product anti-Cdk6 antibody (PB9995)?

E. Bhatt

Verified customer

Asked: 2018-01-17

Answer

We do provide the blocking peptide for product anti-Cdk6 antibody (PB9995). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-01-17

Question

Would anti-Cdk6 antibody PB9995 work for WB with leukemic t-cell?

Verified Customer

Verified customer

Asked: 2018-01-17

Answer

According to the expression profile of leukemic t-cell, CDK6 is highly expressed in leukemic t-cell. So, it is likely that anti-Cdk6 antibody PB9995 will work for WB with leukemic t-cell.

Boster Scientific Support

Answered: 2018-01-17

Question

Do you have a BSA free version of anti-Cdk6 antibody PB9995 available?

Verified Customer

Verified customer

Asked: 2017-06-13

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Cdk6 antibody PB9995 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-06-13

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9995
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.