Overview
Product Name |
Anti-CORD2/CRX Antibody Picoband™
See more CRX/CORD2 products |
Catalog# |
A02202-1 |
Pack Size |
100μg/vial |
Storage & Handling |
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-CORD2/CRX Antibody Picoband™ catalog # A02202-1. Tested in WB applications. This antibody reacts with Human. Supplied as 100μg/vial in Lyophilized form antibody. |
Cite This Product |
Anti-CORD2/CRX Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02202-1)
|
Antibodies Validation |
Antibodies Validation Information
|
Similar Products From Other Companies |
Anti-CORD2/CRX Antibody Picoband™ may replace the following items: sc 81958|sc 30150|sc 22381|sc 377207|sc 377138|sc 22380|sc 30150 X|sc 22381 X|sc 377207 X|sc 377138 X|sc 22380 X. |
Product Specs
Host |
Rabbit |
Reactive Species |
Human |
Applications |
WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences. |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For CRX (Source: Uniprot.org, NCBI)
Uniprot Id | O43186 |
---|
NCBI Gene Id | 1406 |
---|
Species Of This Entry | Human |
---|
Gene Name | CRX |
---|
Protein Name | Cone-rod homeobox protein |
---|
Superfamily | paired homeobox family |
---|
Alternative Names | CRX/CORD2|cone-rod homeobox; CORD2; CRDcone-rod homeobox protein; CRX; LCA7; LCA7orthodenticle homeobox 3; OTX3 |
---|
Molecular Weight | 32261 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on CRX, check out the CRX Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for CRX: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the CRX infographic
Our Boster Quality Guarantee for Anti-CORD2/CRX Antibody Picoband™ covers its use in the following applications.
Western blot, 0.1-0.5μg/ml, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of CORD2 using anti-CORD2 antibody (A02202-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CORD2 antigen affinity purified polyclonal antibody (Catalog # A02202-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CORD2 at approximately 37KD. The expected band size for CORD2 is at 32KD.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A02202-1 Anti-CORD2/CRX Antibody Picoband™
2 Related Questions
Question
We are currently using anti-CORD2/CRX antibody A02202-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on feline tissues as well?
Verified Customer
Asked: 2020-01-24
Answer
The anti-CORD2/CRX antibody (A02202-1) has not been tested for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-24
Question
Is this A02202-1 anti-CORD2/CRX antibody reactive to the isotypes of CRX?
B. Kulkarni
Asked: 2019-08-14
Answer
The immunogen of A02202-1 anti-CORD2/CRX antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-14