Anti-CORD2/CRX Antibody Picoband®

CRX antibody

Boster Bio Anti-CORD2/CRX Antibody Picoband® catalog # A02202-1. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A02202-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-CORD2/CRX Antibody Picoband®

View all CRX Antibodies

SKU/Catalog Number

A02202-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-CORD2/CRX Antibody Picoband® catalog # A02202-1. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-CORD2/CRX Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02202-1)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02202-1 is reactive to CRX in Human

Observed Molecular Weight

37 kDa

Calculated molecular weight

32.3 kDa

Background of CRX

Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A02202-1 is guaranteed for WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman

Tested application

CORD2 antibody was positively detected by WB in:
HEPG2 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-CORD2/CRX Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-CORD2/CRX Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

2 Customer Q&As for Anti-CORD2/CRX Antibody Picoband®

Question

We are currently using anti-CORD2/CRX antibody A02202-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-24

Answer

The anti-CORD2/CRX antibody (A02202-1) has not been tested for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-24

Question

Is this A02202-1 anti-CORD2/CRX antibody reactive to the isotypes of CRX?

B. Kulkarni

Verified customer

Asked: 2019-08-14

Answer

The immunogen of A02202-1 anti-CORD2/CRX antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-08-14

Order DetailsPrice
A02202-1

100μg

$370
A02202-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A02202-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A02202-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A02202-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A02202-1-APC

100 μg APC conjugated (liquid)

$820
A02202-1-FITC

100 μg FITC conjugated (liquid)

$570
A02202-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A02202-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A02202-1-HRP

100 μg HRP conjugated (liquid)

$570
A02202-1-PE

100 μg PE conjugated (liquid)

$820
A02202-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A02202-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 16, 2026