Product Info Summary
SKU: | A02202-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-CORD2/CRX Antibody Picoband™
SKU/Catalog Number
A02202-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-CORD2/CRX Antibody Picoband™ catalog # A02202-1. Tested in WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-CORD2/CRX Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02202-1)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02202-1 is reactive to CRX in Human
Applications
A02202-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
37 kDa
Calculated molecular weight
32.261kDa
Background of CRX/CORD2
Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of CORD2 using anti-CORD2 antibody (A02202-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CORD2 antigen affinity purified polyclonal antibody (Catalog # A02202-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for CORD2 at approximately 37KD. The expected band size for CORD2 is at 32KD.
Protein Target Info & Infographic
Gene/Protein Information For CRX (Source: Uniprot.org, NCBI)
Gene Name
CRX
Full Name
Cone-rod homeobox protein
Weight
32.261kDa
Superfamily
paired homeobox family
Alternative Names
cone-rod homeobox; CORD2; CRDcone-rod homeobox protein; CRX; LCA7; LCA7orthodenticle homeobox 3; OTX3 CRX CORD2, CRD, LCA7, OTX3 cone-rod homeobox cone-rod homeobox protein|orthodenticle homeobox 3
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on CRX, check out the CRX Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for CRX: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-CORD2/CRX Antibody Picoband™ (A02202-1)
Hello CJ!
No publications found for A02202-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-CORD2/CRX Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-CORD2/CRX Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
2 Customer Q&As for Anti-CORD2/CRX Antibody Picoband™
Question
We are currently using anti-CORD2/CRX antibody A02202-1 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it possible that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-24
Answer
The anti-CORD2/CRX antibody (A02202-1) has not been tested for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-24
Question
Is this A02202-1 anti-CORD2/CRX antibody reactive to the isotypes of CRX?
B. Kulkarni
Verified customer
Asked: 2019-08-14
Answer
The immunogen of A02202-1 anti-CORD2/CRX antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-08-14