Anti-Cryptochrome I/CRY1 Antibody Picoband™

Boster Bio Anti-Cryptochrome I/CRY1 Antibody Picoband™ catalog # PB9540. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9540
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Cryptochrome I/CRY1 Antibody Picoband™

See all CRY1 products

SKU/Catalog Number

PB9540

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Cryptochrome I/CRY1 Antibody Picoband™ catalog # PB9540. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Cryptochrome I/CRY1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9540)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Cryptochrome I (153-189aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino aci

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9540 is reactive to CRY1 in Human, Mouse, Rat

Applications

PB9540 is guaranteed for IHC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, Human, By Heat

Validation Images & Assay Conditions

Gene/Protein Information For CRY1 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q16526

Gene ID

1407

Gene Name

CRY1

Full Name

Cryptochrome-1

Weight

66.395kDa

Superfamily

DNA photolyase class-1 family

Alternative Names

CRY1; cryptochrome 1 (photolyase-like); Cryptochrome I; PHLL1; PHLL1cryptochrome-1; photolyase-like cryptochrome 1 CRY1 DSPD, PHLL1 cryptochrome circadian regulator 1 cryptochrome-1|cryptochrome 1 (photolyase-like)|cryptochrome circadian clock 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on CRY1, check out the CRY1 Infographic

CRY1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for CRY1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9540

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Cryptochrome I/CRY1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Cryptochrome I/CRY1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

2 Customer Q&As for Anti-Cryptochrome I/CRY1 Antibody Picoband™

Question

Can PB9540 antibody be used for ICC on human samples?

Verified customer

Asked: 2019-11-01

Answer

The Anti-Cryptochrome I/CRY1 Antibody Picoband PB9540 has not been validated for Immunocytochemistry on human samples. We suggest to run pilot tests.

Boster Scientific Support

Answered: 2019-11-03

Question

We are currently using anti-Cryptochrome I/CRY1 antibody PB9540 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?

Verified Customer

Verified customer

Asked: 2019-07-23

Answer

The anti-Cryptochrome I/CRY1 antibody (PB9540) has not been tested for cross reactivity specifically with horse tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-23

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9540
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.