Anti-EpCAM Antibody Picoband™

EpCAM/TROP1 antibody

Boster Bio Anti-EpCAM Antibody Picoband™ catalog # PB10059. Tested in ELISA, Flow Cytometry, IF, IHC, WB applications. This antibody reacts with Human. Cited in 5 publication(s). Independently reviewed in 1 review(s).

Product Info Summary

SKU: PB10059
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: ELISA, Flow Cytometry, IF, IHC, WB

Product Name

Anti-EpCAM Antibody Picoband™

View all EpCAM/TROP1 Antibodies

SKU/Catalog Number

PB10059

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-EpCAM Antibody Picoband™ catalog # PB10059. Tested in ELISA, Flow Cytometry, IF, IHC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-EpCAM Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10059)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human EPCAM, different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB10059 is reactive to EPCAM in Human

Applications

PB10059 is guaranteed for ELISA, Flow Cytometry, IF, IHC, WB Boster Guarantee

Observed Molecular Weight

40 kDa

Calculated molecular weight

34.932kDa

Background of EpCAM/TROP1

Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By Heat
Immunofluorescence, 2.5μg/ml
Flow Cytometry, 1-3μg/1x106cells
ELISA , 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For EPCAM (Source: Uniprot.org, NCBI)

Gene Name

EPCAM

Full Name

Epithelial cell adhesion molecule

Weight

34.932kDa

Superfamily

EPCAM family

Alternative Names

17-1A; 323/A3; ACSTD1; antigen identified by monoclonal AUA1; CD326 antigen; CD326; Cell surface glycoprotein Trop-1; chromosome 4, surface marker (35kD glycoprotein); DIAR5; EGP; EGP-2; EGP314; EGP40; EpCAM; epithelial cell adhesion molecule; Epithelial cell surface antigen; Epithelial glycoprotein 314; Epithelial glycoprotein; ESA; GA733-2; GA733-2EGP34; gp40; hEGP314; HNPCC8; KS 1/4 antigen; KS1/4; KSAHEA125; M1S2; M4S1; M4S1Ly74; Major gastrointestinal tumor-associated protein GA733-2; MIC18MH99; MOC31; TACST-1; TACSTD1; TROP1; TROP1CD326; Tumor-associated calcium signal transducer 1CO-17A EPCAM DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1 epithelial cell adhesion molecule epithelial cell adhesion molecule|adenocarcinoma-associated antigen|cell surface glycoprotein Trop-1|epithelial glycoprotein 314|human epithelial glycoprotein-2|major gastrointestinal tumor-associated protein GA733-2|membrane component, chromosome 4, surface marker (35kD glycoprotein)|trophoblast cell surface antigen 1|tumor-associated calcium signal transducer 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on EPCAM, check out the EPCAM Infographic

EPCAM infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for EPCAM: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

PB10059 has been cited in 5 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Deformability and size-based cancer cell separation using an integrated microfluidic device

Epithelial cell adhesion molecule promotes breast cancer resistance protein‐mediated multidrug resistance in breast cancer by inducing partial epithelial–mesenchymal transition

Shi R,Liu L,Wang F,He Y,Niu Y,Wang C,Zhang X,Zhang X,Zhang H,Chen M,Wang Y.Downregulation of cytokeratin 18 induces cellular partial EMT and stemness through increasing EpCAM expression in breast cancer.Cell Signal.2020 Dec;76:109810.doi:10.1016/j.cellsig
Species: Human
PB10059 usage in article: APP:WB, SAMPLE:MCF-7 CELL AND MDA-MB-231 CELL, DILUTION:NA

A novel multi-target RNAi adenovirus inhibits hepatoma cell proliferation, migration, and induction of angiogenesis

Zhang Q, Bu S, Sun J, Xu M, Yao X, He K, Lai D. Stem Cell Res Ther. 2017 Nov 28;8(1):270. doi: 10.1186/s13287-017-0721-0. Paracrine effects of human amniotic epithelial cells protect against chemotherapy-induced ovarian damage

Have you used Anti-EpCAM Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

1 Reviews For Anti-EpCAM Antibody Picoband™

0

Immunoflorescence Review for Anti-EpCAM Antibody

Excellent

Application Immunofluorescence (IF)
Blocking step 5% BSA as a blocking agent for 30 min at 37°C
Sample Human rectal
Fixative Fixed with 4% paraformaldehyde
Primary Ab Incubation 4°C overnight
Primary Ab Incubation diluent 5% BSA in TBS
Primary Ab Concentration 1ug/ml
Secondary Antibody SABC kit from Boster Bio, (SA1022
Secondary Ab Dilution The kit was ready to use, no dilution needed
Secondary Ab Incubation at 37°C for 30 min

Verified customer

Submitted

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-EpCAM Antibody Picoband™

Question

Is this PB10059 anti-EpCAM antibody reactive to the isotypes of EPCAM?

Verified Customer

Verified customer

Asked: 2020-03-10

Answer

The immunogen of PB10059 anti-EpCAM antibody is A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen ami. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-10

Question

I have attached the WB image, lot number and protocol we used for placenta using anti-EpCAM antibody PB10059. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-02-28

Question

I was wanting to use your anti-EpCAM antibody for IHC-P for human placenta on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human placenta identification?

Verified Customer

Verified customer

Asked: 2020-02-21

Answer

It shows on the product datasheet, PB10059 anti-EpCAM antibody has been validated for ELISA, Flow Cytometry, IF, IHC-P, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human placenta in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-02-21

Question

I see that the anti-EpCAM antibody PB10059 works with IHC-P, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-02-17

Answer

You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-02-17

Question

Our lab want to know about to test anti-EpCAM antibody PB10059 on human placenta for research purposes, then I may be interested in using anti-EpCAM antibody PB10059 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-02-13

Answer

The products we sell, including anti-EpCAM antibody PB10059, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-02-13

Question

Is there a BSA free version of anti-EpCAM antibody PB10059 available?

Verified Customer

Verified customer

Asked: 2020-01-07

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-EpCAM antibody PB10059 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-01-07

Question

We bought anti-EpCAM antibody for IF on placenta a few years ago. I am using human, and We intend to use the antibody for WB next. My question regards examining placenta as well as lung adenocarcinoma in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2019-09-17

Answer

I have checked the website and datasheets of our anti-EpCAM antibody and it seems that PB10059 has been tested on human in both IF and WB. Thus PB10059 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2019-09-17

Question

Is a blocking peptide available for product anti-EpCAM antibody (PB10059)?

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

We do provide the blocking peptide for product anti-EpCAM antibody (PB10059). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-09-02

Question

Would PB10059 anti-EpCAM antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-07-29

Answer

It shows on the product datasheet, PB10059 anti-EpCAM antibody as been validated on IHC-P. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-07-29

Question

Does anti-EpCAM antibody PB10059 work for IHC-P with placenta?

F. Dhar

Verified customer

Asked: 2018-05-10

Answer

According to the expression profile of placenta, EPCAM is highly expressed in placenta. So, it is likely that anti-EpCAM antibody PB10059 will work for IHC-P with placenta.

Boster Scientific Support

Answered: 2018-05-10

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for placenta using anti-EpCAM antibody PB10059. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-04-10

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-04-10

Question

Our team were content with the WB result of your anti-EpCAM antibody. However we have been able to see positive staining in liver lateral cell membrane using this antibody. Is that expected? Could you tell me where is EPCAM supposed to be expressed?

Verified Customer

Verified customer

Asked: 2018-02-15

Answer

From literature, liver does express EPCAM. Generally EPCAM expresses in lateral cell membrane. Regarding which tissues have EPCAM expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 2333300
Liver, Pubmed ID: 19159218
Lung adenocarcinoma, Pubmed ID: 2463074, 2469722, 2108441
Lymphoma, Pubmed ID: 8382772
Ovary, Pubmed ID: 15489334
Placenta, Pubmed ID: 2911574

Boster Scientific Support

Answered: 2018-02-15

Question

We are currently using anti-EpCAM antibody PB10059 for human tissue, and we are satisfied with the ELISA results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on primate tissues as well?

Verified Customer

Verified customer

Asked: 2018-02-05

Answer

The anti-EpCAM antibody (PB10059) has not been tested for cross reactivity specifically with primate tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in primate you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-02-05

Question

We have been able to see staining in human lung adenocarcinoma. What should we do? Is anti-EpCAM antibody supposed to stain lung adenocarcinoma positively?

Verified Customer

Verified customer

Asked: 2017-11-30

Answer

From literature lung adenocarcinoma does express EPCAM. From Uniprot.org, EPCAM is expressed in jejunal mucosa, lung adenocarcinoma, colon carcinoma, lymphoma, ovary, placenta, liver, among other tissues. Regarding which tissues have EPCAM expression, here are a few articles citing expression in various tissues:
Colon carcinoma, Pubmed ID: 2333300
Liver, Pubmed ID: 19159218
Lung adenocarcinoma, Pubmed ID: 2463074, 2469722, 2108441
Lymphoma, Pubmed ID: 8382772
Ovary, Pubmed ID: 15489334
Placenta, Pubmed ID: 2911574

Boster Scientific Support

Answered: 2017-11-30

Question

My question regarding product PB10059, anti-EpCAM antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2017-10-06

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10059 anti-EpCAM antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2017-10-06

Question

I would like using your anti-EpCAM antibody for positive regulation of cell population proliferation studies. Has this antibody been tested with western blotting on hela whole cell lysates? We would like to see some validation images before ordering.

H. Krishna

Verified customer

Asked: 2013-01-09

Answer

I appreciate your inquiry. This PB10059 anti-EpCAM antibody is tested on hela whole cell lysates, a549 whole cell lysates, colon organoid tissue, a431 cells. It is guaranteed to work for ELISA, Flow Cytometry, IF, IHC-P, WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2013-01-09

Order DetailsPrice
PB10059

100μg

$370
PB10059-10ug

10μg sample (liquid)

$99
PB10059-Biotin

100 μg Biotin conjugated

$570
PB10059-Cy3

100 μg Cy3 conjugated

$570
PB10059-Dylight488

100 μg Dylight488 conjugated

$570
PB10059-Dylight550

100 μg Dylight550 conjugated

$570
PB10059-Dylight594

100 μg Dylight594 conjugated

$570
PB10059-FITC

100 μg FITC conjugated

$570
PB10059-HRP

100 μg HRP conjugated

$570
PB10059-APC

100 μg APC conjugated

$670
PB10059-PE

100 μg PE conjugated

$670
PB10059-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
PB10059
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.