Anti-ErbB 2/ERBB2 Antibody Picoband™

Boster Bio Anti-ErbB 2/ERBB2 Antibody Picoband™ catalog # A00010-2. Tested in IHC, WB applications. This antibody reacts with Human, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: A00010-2
Size: 100μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-ErbB 2/ERBB2 Antibody Picoband™

See all ErbB2/Her2 products

SKU/Catalog Number

A00010-2

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ErbB 2/ERBB2 Antibody Picoband™ catalog # A00010-2. Tested in IHC, WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ErbB 2/ERBB2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00010-2)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A00010-2 is reactive to ERBB2 in Human, Rat

Applications

A00010-2 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For ERBB2 (Source: Uniprot.Org, NCBI)

Uniprot ID

P04626

Gene ID

2064

Gene Name

ERBB2

Full Name

Receptor tyrosine-protein kinase erbB-2

Weight

137.91kDa

Superfamily

protein kinase superfamily

Alternative Names

CD340 antigen; CD340; c-erb B2/neu protein; EC 2.7.10; EGFR2; ErbB2; HER2; HER-2; HER2EC 2.7.10.1; herstatin; Metastatic lymph node gene 19 protein; MLN 19; MLN19; Neu Oncogene; NEUHER-2/neu; neuroblastoma/glioblastoma derived oncogene homolog; NGL; NGLTKR1; p185erbB2; Proto-oncogene c-ErbB-2; Proto-oncogene Neu; receptor tyrosine-protein kinase erbB-2; TKR1; Tyrosine kinase-type cell surface receptor HER2; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2(neuro/glioblastoma derived oncogene homolog); v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastomade ERBB2 CD340, HER-2, HER-2/neu, HER2, MLN 19, NEU, NGL, TKR1 erb-b2 receptor tyrosine kinase 2 receptor tyrosine-protein kinase erbB-2|c-erb B2/neu protein|herstatin|human epidermal growth factor receptor 2|metastatic lymph node gene 19 protein|neuro/glioblastoma derived oncogene homolog|neuroblastoma/glioblastoma derived oncogene homolog|proto-oncogene Neu|proto-oncogene c-ErbB-2|tyrosine kinase-type cell surface receptor HER2|v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 2|v-erb-b2 avian erythroblastic leukemia viral oncoprotein 2|v-erb-b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ERBB2, check out the ERBB2 Infographic

ERBB2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ERBB2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A00010-2 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

Lapatinib-incorporated lipoprotein-like nanoparticles: preparation and a proposed breast cancer-targeting mechanism

Tong ZJ, Shi NY, Zhang ZJ, Yuan XD, Hong XM. Biosci Rep. 2017 Aug 2;37(4). pii: BSR20170121. doi: 10.1042/BSR20170121. Print 2017 Aug 31. Expression and prognostic value of HER-2/neu in primary breast cancer with sentinel lymph node metastasis

Tao L, Suhua C, Juanjuan C, Zongzhi Y, Juan X, Dandan Z. Virol J. 2011 Mar 11;8:114. Doi: 10.1186/1743-422X-8-114. In Vitro Study On Human Cytomegalovirus Affecting Early Pregnancy Villous Evt'S Invasion Function.

Have you used Anti-ErbB 2/ERBB2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ErbB 2/ERBB2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

16 Customer Q&As for Anti-ErbB 2/ERBB2 Antibody Picoband™

Question

Does A00010-2 anti-ErbB 2/ERBB2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

V. Gonzalez

Verified customer

Asked: 2020-05-08

Answer

As indicated on the product datasheet, A00010-2 anti-ErbB 2/ERBB2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-05-08

Question

I am interested in using your anti-ErbB 2/ERBB2 antibody for positive regulation of cell adhesion studies. Has this antibody been tested with western blotting on hepg2 whole cell lysates? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2020-03-12

Answer

Thanks for your inquiry. This A00010-2 anti-ErbB 2/ERBB2 antibody is validated on hepg2 whole cell lysates. It is guaranteed to work for IHC, WB in human, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2020-03-12

Question

We have been able to see staining in rat fetal brain. Any tips? Is anti-ErbB 2/ERBB2 antibody supposed to stain fetal brain positively?

Verified Customer

Verified customer

Asked: 2020-02-28

Answer

Based on literature fetal brain does express ERBB2. Based on Uniprot.org, ERBB2 is expressed in esophagus mucosa, brain, fetal brain, mammary carcinoma, cervix carcinoma, cervix carcinoma erythroleukemia, liver, among other tissues. Regarding which tissues have ERBB2 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Fetal brain, Pubmed ID: 24722188
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 2992089

Boster Scientific Support

Answered: 2020-02-28

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain using anti-ErbB 2/ERBB2 antibody A00010-2. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-01-30

Answer

I appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-01-30

Question

you antibody to test anti-ErbB 2/ERBB2 antibody A00010-2 on human fetal brain for research purposes, then I may be interested in using anti-ErbB 2/ERBB2 antibody A00010-2 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-12-30

Answer

The products we sell, including anti-ErbB 2/ERBB2 antibody A00010-2, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-12-30

Question

Is this A00010-2 anti-ErbB 2/ERBB2 antibody reactive to the isotypes of ERBB2?

Verified Customer

Verified customer

Asked: 2019-07-17

Answer

The immunogen of A00010-2 anti-ErbB 2/ERBB2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ErbB 2 (29-64aa TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-07-17

Question

I have a question about product A00010-2, anti-ErbB 2/ERBB2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-03-29

Answer

We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00010-2 anti-ErbB 2/ERBB2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-03-29

Question

Do you have a BSA free version of anti-ErbB 2/ERBB2 antibody A00010-2 available?

M. Parker

Verified customer

Asked: 2019-03-12

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-ErbB 2/ERBB2 antibody A00010-2 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-03-12

Question

See attached the WB image, lot number and protocol we used for fetal brain using anti-ErbB 2/ERBB2 antibody A00010-2. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-01-25

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-01-25

Question

We ordered your anti-ErbB 2/ERBB2 antibody for IHC on cervix carcinoma a few years ago. I am using human, and We intend to use the antibody for WB next. We are interested in examining cervix carcinoma as well as mammary carcinoma in our next experiment. Could you please give me some suggestion on which antibody would work the best for WB?

Verified Customer

Verified customer

Asked: 2018-12-10

Answer

I viewed the website and datasheets of our anti-ErbB 2/ERBB2 antibody and I see that A00010-2 has been validated on human in both IHC and WB. Thus A00010-2 should work for your application. Our Boster satisfaction guarantee will cover this product for WB in human even if the specific tissue type has not been validated. We do have a comprehensive range of products for WB detection and you can check out our website bosterbio.com to find out more information about them.

Boster Scientific Support

Answered: 2018-12-10

Question

We are currently using anti-ErbB 2/ERBB2 antibody A00010-2 for human tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on zebrafish tissues as well?

L. Brown

Verified customer

Asked: 2017-12-08

Answer

The anti-ErbB 2/ERBB2 antibody (A00010-2) has not been tested for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-12-08

Question

We were content with the WB result of your anti-ErbB 2/ERBB2 antibody. However we have been able to see positive staining in fetal brain isoform 1: cell membrane using this antibody. Is that expected? Could you tell me where is ERBB2 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2017-11-16

Answer

According to literature, fetal brain does express ERBB2. Generally ERBB2 expresses in isoform 1: cell membrane, isoform 2: cytoplasm. nucleus., isoform 3: cytoplasm. nucleus. Regarding which tissues have ERBB2 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Fetal brain, Pubmed ID: 24722188
Liver, Pubmed ID: 24275569
Mammary carcinoma, Pubmed ID: 2992089

Boster Scientific Support

Answered: 2017-11-16

Question

I was wanting to use your anti-ErbB 2/ERBB2 antibody for WB for human fetal brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human fetal brain identification?

S. Zhang

Verified customer

Asked: 2016-05-31

Answer

It shows on the product datasheet, A00010-2 anti-ErbB 2/ERBB2 antibody has been tested for IHC, WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human fetal brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2016-05-31

Question

I see that the anti-ErbB 2/ERBB2 antibody A00010-2 works with WB, what is the protocol used to produce the result images on the product page?

M. Singh

Verified customer

Asked: 2013-12-04

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2013-12-04

Question

Is a blocking peptide available for product anti-ErbB 2/ERBB2 antibody (A00010-2)?

D. Collins

Verified customer

Asked: 2013-08-28

Answer

We do provide the blocking peptide for product anti-ErbB 2/ERBB2 antibody (A00010-2). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2013-08-28

Question

Will anti-ErbB 2/ERBB2 antibody A00010-2 work for WB with fetal brain?

J. Mitchell

Verified customer

Asked: 2013-03-19

Answer

According to the expression profile of fetal brain, ERBB2 is highly expressed in fetal brain. So, it is likely that anti-ErbB 2/ERBB2 antibody A00010-2 will work for WB with fetal brain.

Boster Scientific Support

Answered: 2013-03-19

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A00010-2
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.