Product Info Summary
| SKU: | A02191-1 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | IF, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Frizzled 4/FZD4 Antibody Picoband®
SKU/Catalog Number
A02191-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Frizzled 4/FZD4 Antibody Picoband® catalog # A02191-1. Tested in ICC/IF, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Frizzled 4/FZD4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02191-1)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Frizzled 4, identical to the related mouse and rat sequences.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A02191-1 is reactive to FZD4 in Human, Mouse, Rat
Observed Molecular Weight
60 kDa
Calculated molecular weight
59.9 kDa
Background of FZD4
Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
A02191-1 is guaranteed for IF, ICC, WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Western blot | 0.1-0.5μg/ml | Human, Mouse, Rat |
| Immunocytochemistry/Immunofluorescence | 5 μg/ml | Human |
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of Frizzled 4 using anti-Frizzled 4 antibody (A02191-1).
Electrophoresis was performed on a 10% SDS-PAGE gel at 80V (Stacking gel) / 120V (Resolving gel) for 2 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human HepG2 whole cell lysates,
Lane 2: human PC-3 whole cell lysates,
Lane 3: human K562 whole cell lysates,
Lane 4: human RT4 whole cell lysates,
Lane 5: rat lung tissue lysates,
Lane 6: mouse kidney tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Frizzled 4 antigen affinity purified polyclonal antibody (A02191-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody (Catalog # BA1054) at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an ECL Plus Western Blotting Substrate (Catalog # AR1196-200) with Tanon 5200 system. A specific band was detected for Frizzled 4 at approximately 60 kDa. The expected band size for Frizzled 4 is at 60 kDa
Click image to see more details
IF analysis of Frizzled 4 using anti-Frizzled 4 antibody (A02191-1).
Frizzled 4 was detected in an immunocytochemical section of HepG2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 μg/mL rabbit anti-Frizzled 4 Antibody (A02191-1) overnight at 4°C. Cy3 Conjugated Goat Anti-Rabbit IgG (BA1032) was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Specific Publications For Anti-Frizzled 4/FZD4 Antibody Picoband® (A02191-1)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Frizzled 4/FZD4 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Frizzled 4/FZD4 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-Frizzled 4/FZD4 Antibody Picoband®
Question
We are currently using anti-Frizzled 4/FZD4 antibody A02191-1 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2020-05-01
Answer
The anti-Frizzled 4/FZD4 antibody (A02191-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-05-01
Question
I see that the anti-Frizzled 4/FZD4 antibody A02191-1 works with WB, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2019-12-02
Answer
You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com
Boster Scientific Support
Answered: 2019-12-02
Question
Does anti-Frizzled 4/FZD4 antibody A02191-1 work for WB with adipose tissue of abdominal region?
Verified Customer
Verified customer
Asked: 2019-09-02
Answer
According to the expression profile of adipose tissue of abdominal region, FZD4 is highly expressed in adipose tissue of abdominal region. So, it is likely that anti-Frizzled 4/FZD4 antibody A02191-1 will work for WB with adipose tissue of abdominal region.
Boster Scientific Support
Answered: 2019-09-02
Question
Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for adipose tissue of abdominal region using anti-Frizzled 4/FZD4 antibody A02191-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2018-12-11
Answer
Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-12-11
Question
I was wanting to use your anti-Frizzled 4/FZD4 antibody for WB for mouse adipose tissue of abdominal region on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse adipose tissue of abdominal region identification?
J. Miller
Verified customer
Asked: 2017-09-06
Answer
You can see on the product datasheet, A02191-1 anti-Frizzled 4/FZD4 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse adipose tissue of abdominal region in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2017-09-06
Question
My lab would like to test anti-Frizzled 4/FZD4 antibody A02191-1 on mouse adipose tissue of abdominal region for research purposes, then I may be interested in using anti-Frizzled 4/FZD4 antibody A02191-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Verified customer
Asked: 2017-06-06
Answer
The products we sell, including anti-Frizzled 4/FZD4 antibody A02191-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2017-06-06
Question
Is this A02191-1 anti-Frizzled 4/FZD4 antibody reactive to the isotypes of FZD4?
C. Zhang
Verified customer
Asked: 2013-04-22
Answer
The immunogen of A02191-1 anti-Frizzled 4/FZD4 antibody is A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2013-04-22

