Anti-Frizzled 4/FZD4 Antibody Picoband®

FZD4 antibody

Boster Bio Anti-Frizzled 4/FZD4 Antibody Picoband® catalog # A02191-1. Tested in ICC/IF, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 2 publication(s).

Product Info Summary

SKU: A02191-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Frizzled 4/FZD4 Antibody Picoband®

View all FZD4 Antibodies

SKU/Catalog Number

A02191-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Frizzled 4/FZD4 Antibody Picoband® catalog # A02191-1. Tested in ICC/IF, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Frizzled 4/FZD4 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02191-1)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human Frizzled 4, identical to the related mouse and rat sequences.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02191-1 is reactive to FZD4 in Human, Mouse, Rat

Observed Molecular Weight

60 kDa

Calculated molecular weight

59.9 kDa

Background of FZD4

Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A02191-1 is guaranteed for IF, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Mouse, Rat
Immunocytochemistry/Immunofluorescence5 μg/mlHuman

Tested application

Frizzled antibody was positively detected by WB in:
human HepG2 whole cell, human PC-3 whole cell, human K562 whole cell, human RT4 whole cell, rat lung tissue, mouse kidney tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Frizzled antibody was positively detected by ICC/IF in:
HepG2 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-Frizzled 4/FZD4 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-Frizzled 4/FZD4 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-Frizzled 4/FZD4 Antibody Picoband®

Question

We are currently using anti-Frizzled 4/FZD4 antibody A02191-1 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on feline tissues as well?

Verified Customer

Verified customer

Asked: 2020-05-01

Answer

The anti-Frizzled 4/FZD4 antibody (A02191-1) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-05-01

Question

I see that the anti-Frizzled 4/FZD4 antibody A02191-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-12-02

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2019-12-02

Question

Does anti-Frizzled 4/FZD4 antibody A02191-1 work for WB with adipose tissue of abdominal region?

Verified Customer

Verified customer

Asked: 2019-09-02

Answer

According to the expression profile of adipose tissue of abdominal region, FZD4 is highly expressed in adipose tissue of abdominal region. So, it is likely that anti-Frizzled 4/FZD4 antibody A02191-1 will work for WB with adipose tissue of abdominal region.

Boster Scientific Support

Answered: 2019-09-02

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for adipose tissue of abdominal region using anti-Frizzled 4/FZD4 antibody A02191-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-12-11

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-12-11

Question

I was wanting to use your anti-Frizzled 4/FZD4 antibody for WB for mouse adipose tissue of abdominal region on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for mouse adipose tissue of abdominal region identification?

J. Miller

Verified customer

Asked: 2017-09-06

Answer

You can see on the product datasheet, A02191-1 anti-Frizzled 4/FZD4 antibody has been tested for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse adipose tissue of abdominal region in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-09-06

Question

My lab would like to test anti-Frizzled 4/FZD4 antibody A02191-1 on mouse adipose tissue of abdominal region for research purposes, then I may be interested in using anti-Frizzled 4/FZD4 antibody A02191-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2017-06-06

Answer

The products we sell, including anti-Frizzled 4/FZD4 antibody A02191-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-06-06

Question

Is this A02191-1 anti-Frizzled 4/FZD4 antibody reactive to the isotypes of FZD4?

C. Zhang

Verified customer

Asked: 2013-04-22

Answer

The immunogen of A02191-1 anti-Frizzled 4/FZD4 antibody is A synthetic peptide corresponding to a sequence of human Frizzled 4 (QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2013-04-22

Order DetailsPrice
A02191-1

100μg

$370
A02191-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A02191-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A02191-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A02191-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A02191-1-APC

100 μg APC conjugated (liquid)

$820
A02191-1-FITC

100 μg FITC conjugated (liquid)

$570
A02191-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A02191-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A02191-1-HRP

100 μg HRP conjugated (liquid)

$570
A02191-1-PE

100 μg PE conjugated (liquid)

$820
A02191-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A02191-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Oct 1, 2026