Product Info Summary
SKU: | A01548 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human |
Host: | Rabbit |
Application: | IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-GAA Antibody Picoband™
SKU/Catalog Number
A01548
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-GAA Antibody Picoband™ catalog # A01548. Tested in IHC, WB applications. This antibody reacts with Human.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-GAA Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01548)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human GAA, different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins
Reactive Species
A01548 is reactive to GAA in Human
Applications
A01548 is guaranteed for IHC, WB Boster Guarantee
Observed Molecular Weight
110 kDa, 95kDa, 76kDa, 70 kDa
Calculated molecular weight
105.324kDa
Background of LYAG/GAA
Lysosomal alpha-glucosidase is an enzyme that in humans is encoded by the GAA gene. This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Alternative splicing results in multiple transcript variants.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Western blot, 0.1-0.5μg/ml, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of GAA using anti-GAA antibody (A01548).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human A549 whole cell lysates,
Lane 2: human HepG2 whole cell lysates,
Lane 3: human HEK293 whole cell lysates,
Lane 4: human PC-3 whole cell lysates,
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GAA antigen affinity purified polyclonal antibody (Catalog # A01548) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for GAA at approximately 110,95,76,70KD. The expected band size for GAA is at 110,95,76,70KD.
Click image to see more details
Figure 2. IHC analysis of GAA using anti-GAA antibody (A01548).
GAA was detected in paraffin-embedded section of human liver cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-GAA Antibody (A01548) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Click image to see more details
Figure 3. IHC analysis of GAA using anti-GAA antibody (A01548).
GAA was detected in paraffin-embedded section of human prostatic cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/ml rabbit anti-GAA Antibody (A01548) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
Protein Target Info & Infographic
Gene/Protein Information For GAA (Source: Uniprot.org, NCBI)
Gene Name
GAA
Full Name
Lysosomal alpha-glucosidase
Weight
105.324kDa
Superfamily
glycosyl hydrolase 31 family
Alternative Names
Acid alpha-Glucosidase; Acid Maltase; Aglucosidase alfa; EC 3.2.1.20; GAA; glucosidase, alpha; acid; LYAG; Lysosomal alphaGlucosidase; Lysosomal alpha-Glucosidase GAA LYAG alpha glucosidase lysosomal alpha-glucosidase|acid maltase|aglucosidase alfa|glucosidase alpha, acid
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on GAA, check out the GAA Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for GAA: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-GAA Antibody Picoband™ (A01548)
Hello CJ!
No publications found for A01548
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-GAA Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-GAA Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-GAA Antibody Picoband™
Question
Is this A01548 anti-GAA antibody reactive to the isotypes of GAA?
Verified Customer
Verified customer
Asked: 2020-03-24
Answer
The immunogen of A01548 anti-GAA antibody is A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-03-24
Question
A customer had questions regarding A01548. Are there any other WB images available? They customer usually see GAA detected at kDa higher than 70. What is the current stock of current batch of A01548? The customer is interested in purchasing 1mg or more. If more needs to be produced, what is the lead time?
Verified Customer
Verified customer
Asked: 2019-12-18
Answer
1.We don't have other available images. According to Uniprot, there are two molecular weights of the GAA protein, 70 and 76kDa. https://www.uniprot.org/uniprot/P10253#ptm_processing?tdsourcetag=s_pcqq_aiomsg The 105 kDa GAA can be cleaved into 70 kDa or 76 kDa form. 2. We have 20mg in stock.
Boster Scientific Support
Answered: 2019-12-18
Question
Do you have a BSA free version of anti-GAA antibody A01548 available?
Verified Customer
Verified customer
Asked: 2018-03-23
Answer
Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-GAA antibody A01548 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.
Boster Scientific Support
Answered: 2018-03-23
Question
I see that the anti-GAA antibody A01548 works with IHC-P, what is the protocol used to produce the result images on the product page?
Verified Customer
Verified customer
Asked: 2018-02-13
Answer
You can find protocols for IHC-P on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]
Boster Scientific Support
Answered: 2018-02-13