Anti-GPCR LGR8/RXFP2 Antibody Picoband™

Boster Bio Anti-GPCR LGR8/RXFP2 Antibody Picoband™ catalog # A04848-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A04848-1
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, WB

Product Name

Anti-GPCR LGR8/RXFP2 Antibody Picoband™

See all Relaxin R2/LGR8 products

SKU/Catalog Number

A04848-1

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-GPCR LGR8/RXFP2 Antibody Picoband™ catalog # A04848-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-GPCR LGR8/RXFP2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A04848-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A04848-1 is reactive to RXFP2 in Human

Applications

A04848-1 is guaranteed for Flow Cytometry, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For RXFP2 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q8WXD0

Gene ID

122042

Gene Name

RXFP2

Full Name

Relaxin receptor 2

Weight

86.453kDa

Superfamily

G-protein coupled receptor 1 family

Alternative Names

G protein coupled receptor affecting testicular descent; Gpr106; GPR106G-protein coupled receptor 106; Great; GREATRelaxin family peptide receptor 2; INSL3R; leucine-rich repeat-containing G protein-coupled receptor 8; Leucine-rich repeat-containing G-protein coupled receptor 8; Lgr8; LGR8.1; LGR8G-protein coupled receptor affecting testicular descent; Relaxin R2; relaxin receptor 2; relaxin/insulin-like family peptide receptor 2; RelaxinR2; RLN2R; Rxfp2; RXFPR2 RXFP2 GPR106, GREAT, INSL3R, LGR8, LGR8.1, RXFPR2 relaxin family peptide receptor 2 relaxin receptor 2|G protein coupled receptor affecting testicular descent|G-protein coupled receptor 106|leucine-rich repeat-containing G-protein coupled receptor 8|relaxin/insulin like family peptide receptor 2

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on RXFP2, check out the RXFP2 Infographic

RXFP2 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for RXFP2: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A04848-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-GPCR LGR8/RXFP2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-GPCR LGR8/RXFP2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

13 Customer Q&As for Anti-GPCR LGR8/RXFP2 Antibody Picoband™

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for leukocyte using anti-GPCR LGR8/RXFP2 antibody A04848-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2020-04-28

Answer

Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2020-04-28

Question

Is this A04848-1 anti-GPCR LGR8/RXFP2 antibody reactive to the isotypes of RXFP2?

Verified Customer

Verified customer

Asked: 2019-11-11

Answer

The immunogen of A04848-1 anti-GPCR LGR8/RXFP2 antibody is A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-11-11

Question

I am interested in to test anti-GPCR LGR8/RXFP2 antibody A04848-1 on human leukocyte for research purposes, then I may be interested in using anti-GPCR LGR8/RXFP2 antibody A04848-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-11-06

Answer

The products we sell, including anti-GPCR LGR8/RXFP2 antibody A04848-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-06

Question

We are currently using anti-GPCR LGR8/RXFP2 antibody A04848-1 for human tissue, and we are satisfied with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-12

Answer

The anti-GPCR LGR8/RXFP2 antibody (A04848-1) has not been tested for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-12

Question

Do you have a BSA free version of anti-GPCR LGR8/RXFP2 antibody A04848-1 available?

Verified Customer

Verified customer

Asked: 2019-08-27

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-GPCR LGR8/RXFP2 antibody A04848-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-08-27

Question

I see that the anti-GPCR LGR8/RXFP2 antibody A04848-1 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2019-06-07

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2019-06-07

Question

Does anti-GPCR LGR8/RXFP2 antibody A04848-1 work on zebrafish Flow Cytometry with leukocyte?

Verified Customer

Verified customer

Asked: 2019-05-31

Answer

Our lab technicians have not tested anti-GPCR LGR8/RXFP2 antibody A04848-1 on zebrafish. You can run a BLAST between zebrafish and the immunogen sequence of anti-GPCR LGR8/RXFP2 antibody A04848-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated zebrafish samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in zebrafish leukocyte in Flow Cytometry, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-05-31

Question

I have a question about product A04848-1, anti-GPCR LGR8/RXFP2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-05-22

Answer

We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A04848-1 anti-GPCR LGR8/RXFP2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-05-22

Question

Please see the WB image, lot number and protocol we used for leukocyte using anti-GPCR LGR8/RXFP2 antibody A04848-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2017-09-22

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-09-22

Question

I was wanting to use your anti-GPCR LGR8/RXFP2 antibody for Flow Cytometry for human leukocyte on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human leukocyte identification?

D. Thomas

Verified customer

Asked: 2017-07-27

Answer

You can see on the product datasheet, A04848-1 anti-GPCR LGR8/RXFP2 antibody has been validated for Flow Cytometry, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human leukocyte in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-07-27

Question

Is a blocking peptide available for product anti-GPCR LGR8/RXFP2 antibody (A04848-1)?

Verified Customer

Verified customer

Asked: 2017-06-09

Answer

We do provide the blocking peptide for product anti-GPCR LGR8/RXFP2 antibody (A04848-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2017-06-09

Question

Will A04848-1 anti-GPCR LGR8/RXFP2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

W. Kulkarni

Verified customer

Asked: 2016-04-04

Answer

You can see on the product datasheet, A04848-1 anti-GPCR LGR8/RXFP2 antibody as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2016-04-04

Question

Will anti-GPCR LGR8/RXFP2 antibody A04848-1 work for Flow Cytometry with leukocyte?

L. Moore

Verified customer

Asked: 2014-07-29

Answer

According to the expression profile of leukocyte, RXFP2 is highly expressed in leukocyte. So, it is likely that anti-GPCR LGR8/RXFP2 antibody A04848-1 will work for Flow Cytometry with leukocyte.

Boster Scientific Support

Answered: 2014-07-29

Conjugation

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A04848-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.