Anti-HtrA3 Antibody Picoband™

Boster Bio Anti-HtrA3 Antibody Picoband™ catalog # A05478. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A05478
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-HtrA3 Antibody Picoband™

See all HTRA3 products

SKU/Catalog Number

A05478

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-HtrA3 Antibody Picoband™ catalog # A05478. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-HtrA3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05478)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A05478 is reactive to HTRA3 in Human

Applications

A05478 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For HTRA3 (Source: Uniprot.Org, NCBI)

Uniprot ID

P83110

Gene ID

94031

Gene Name

HTRA3

Full Name

Serine protease HTRA3

Weight

48.608kDa

Superfamily

peptidase S1C family

Alternative Names

EC 3.4.21; EC 3.4.21.-; EC 3.4.21.108; High-temperature requirement factor A3; HTRA 3; HtrA serine peptidase 3; HTRA3; Pregnancy-related serine protease; probable serine protease HTRA3; Prsp; serine protease HTRA3; Tasp HTRA3 Prsp, Tasp HtrA serine peptidase 3 serine protease HTRA3|high-temperature requirement factor A3|pregnancy-related serine protease|probable serine protease HTRA3

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on HTRA3, check out the HTRA3 Infographic

HTRA3 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for HTRA3: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A05478

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-HtrA3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-HtrA3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

3 Customer Q&As for Anti-HtrA3 Antibody Picoband™

Question

Is this A05478 anti-HtrA3 antibody reactive to the isotypes of HTRA3?

Verified Customer

Verified customer

Asked: 2020-03-03

Answer

The immunogen of A05478 anti-HtrA3 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human HtrA3 (330-362aa FAIPSDRITRFLTEFQDKQIKDWKKRFIGIRMR), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-03

Question

We are currently using anti-HtrA3 antibody A05478 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2019-09-11

Answer

The anti-HtrA3 antibody (A05478) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-09-11

Question

Will anti-HtrA3 antibody A05478 work on feline WB with apex of heart?

Verified Customer

Verified customer

Asked: 2018-05-09

Answer

Our lab technicians have not validated anti-HtrA3 antibody A05478 on feline. You can run a BLAST between feline and the immunogen sequence of anti-HtrA3 antibody A05478 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated feline samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in feline apex of heart in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-05-09

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
A05478
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.