Anti-ITLN1 Antibody Picoband®

ITLN1 antibody

Boster Bio Anti-ITLN1 Antibody Picoband® catalog # PB10004. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 1 publication(s).

Product Info Summary

SKU: PB10004
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IF, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-ITLN1 Antibody Picoband®

View all ITLN1 Antibodies

SKU/Catalog Number

PB10004
PB1055 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ITLN1 Antibody Picoband® catalog # PB10004. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ITLN1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10004)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB10004 is reactive to ITLN1 in Human

Observed Molecular Weight

43 kDa

Calculated molecular weight

35.0 kDa

Background of ITLN1

Intelectin-1, also known as omentin, is an intelectin encoded in humans by the ITLN1 gene. This gene is mapped to chromosome 1q21.3-q22 by genomic sequence analysis. It is expressed on multiple cell types and appears to participate in insulin signaling and microbe recognition. Intelectin-1 functions both as a receptor for bacterial arabinogalactans and for lactoferrin. Having conserved ligand binding site residues, both human and mouse intelectin-1 bind the exocyclic vicinal diol of carbohydrate ligands such as galactofuranose.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB10004 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman
Immunocytochemistry/Immunofluorescence2μg/mlHuman
Flow Cytometry (Fixed)1-3μg/1x106 cellsHuman

Tested application

ITLN1 antibody was positively detected by WB in:
SW620 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
ITLN1 antibody was positively detected by IHC in:
human intestinal cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
ITLN1 antibody was positively detected by IF in:
U20S cell
ITLN1 antibody was positively detected by FC in:
U937 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-ITLN1 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-ITLN1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-ITLN1 Antibody Picoband®

Question

We are currently using anti-ITLN1 antibody PB10004 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on canine tissues as well?

Verified Customer

Verified customer

Asked: 2020-04-09

Answer

The anti-ITLN1 antibody (PB10004) has not been validated for cross reactivity specifically with canine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-04-09

Question

I have a question about product PB10004, anti-ITLN1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2020-03-23

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10004 anti-ITLN1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2020-03-23

Question

Please see the WB image, lot number and protocol we used for ovary using anti-ITLN1 antibody PB10004. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-08-19

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-19

Question

Is this PB10004 anti-ITLN1 antibody reactive to the isotypes of ITLN1?

Verified Customer

Verified customer

Asked: 2019-06-11

Answer

The immunogen of PB10004 anti-ITLN1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ITLN1 (19-59aa TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-06-11

Question

We want to test anti-ITLN1 antibody PB10004 on human ovary for research purposes, then I may be interested in using anti-ITLN1 antibody PB10004 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

J. Miller

Verified customer

Asked: 2019-05-24

Answer

The products we sell, including anti-ITLN1 antibody PB10004, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-24

Question

Would anti-ITLN1 antibody PB10004 work on horse WB with lung?

Verified Customer

Verified customer

Asked: 2018-12-24

Answer

Our lab technicians have not tested anti-ITLN1 antibody PB10004 on horse. You can run a BLAST between horse and the immunogen sequence of anti-ITLN1 antibody PB10004 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse lung in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-12-24

Question

I see that the anti-ITLN1 antibody PB10004 works with IHC, what is the protocol used to produce the result images on the product page?

C. Wu

Verified customer

Asked: 2014-08-18

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2014-08-18

Order DetailsPrice
PB10004

100μg

$370
PB10004-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB10004-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB10004-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB10004-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB10004-APC

100 μg APC conjugated (liquid)

$820
PB10004-FITC

100 μg FITC conjugated (liquid)

$570
PB10004-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB10004-Biotin

100 μg Biotin conjugated (liquid)

$570
PB10004-HRP

100 μg HRP conjugated (liquid)

$570
PB10004-PE

100 μg PE conjugated (liquid)

$820
PB10004-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10004
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 19, 2026