Anti-KiSS1 receptor/KISS1R Antibody Picoband™

KiSS1R/GPR54 antibody

Boster Bio Anti-KiSS1 receptor/KISS1R Antibody Picoband™ catalog # A01364-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A01364-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-KiSS1 receptor/KISS1R Antibody Picoband™

View all KiSS1R/GPR54 Antibodies

SKU/Catalog Number

A01364-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-KiSS1 receptor/KISS1R Antibody Picoband™ catalog # A01364-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-KiSS1 receptor/KISS1R Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01364-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human KiSS1 receptor, which shares 82.4% amino acid (aa) sequence identity with both mouse and rat KiSS1 receptor.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A01364-1 is reactive to Kiss1r in Human, Mouse, Rat

Applications

A01364-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

43 kDa

Calculated molecular weight

42.889kDa

Background of KiSS1R/GPR54

The KiSS1-derived peptide receptor (also known as GPR54 or the Kisspeptin receptor) is a G protein-coupled receptor which binds the peptide hormone kisspeptin (metastin). Kisspeptin is involved in the regulation of endocrine function and the onset of puberty, with activation of the kisspeptin receptor triggering release of gonadotropin-releasing hormone (GnRH), and release of kisspeptin itself being inhibited by oestradiol but enhanced by GnRH. Reductions in kisspeptin levels with age may conversely be one of the reasons behind age-related declines in levels of other endocrine hormones such as luteinizing hormone.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For Kiss1r (Source: Uniprot.org, NCBI)

Gene Name

Kiss1r

Full Name

KiSS-1 receptor

Weight

42.889kDa

Superfamily

G-protein coupled receptor 1 family

Alternative Names

AXOR12; AXOR12hypogonadotropin-1; G protein-coupled receptor 54; GPR54; GPR54kiSS-1R; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; HOT7T175; Hypogonadotropin-1; KISS1 receptor; kiSS-1 receptor; KiSS1R; KiSS-1R; Kisspeptins receptor; Metastin Receptor; OT7T175 Kiss1r|Gpr54|KISS1 receptor|kiSS-1 receptor|G protein-coupled receptor 54|G-protein coupled receptor OT7T175|kiSS-|kiSS-1R|kisspeptins receptor|metastin receptor|orphan G protein-coupled receptor GPR54|rOT7T175

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Kiss1r, check out the Kiss1r Infographic

Kiss1r infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Kiss1r: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A01364-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-KiSS1 receptor/KISS1R Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-KiSS1 receptor/KISS1R Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-KiSS1 receptor/KISS1R Antibody Picoband™

Question

Is this A01364-1 anti-KiSS1 receptor/KISS1R antibody reactive to the isotypes of KISS1R?

Verified Customer

Verified customer

Asked: 2020-03-12

Answer

The immunogen of A01364-1 anti-KiSS1 receptor/KISS1R antibody is A synthetic peptide corresponding to a sequence of human KiSS1 receptor (MLRHLGRVAVRPAPADSALQGQVLAERAGAVRAK). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-03-12

Question

Is a blocking peptide available for product anti-KiSS1 receptor/KISS1R antibody (A01364-1)?

Verified Customer

Verified customer

Asked: 2020-01-28

Answer

We do provide the blocking peptide for product anti-KiSS1 receptor/KISS1R antibody (A01364-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-01-28

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-KiSS1 receptor/KISS1R antibody A01364-1. Let me know if you need anything else.

L. Krishna

Verified customer

Asked: 2019-11-06

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-06

Question

We are currently using anti-KiSS1 receptor/KISS1R antibody A01364-1 for rat tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2019-10-21

Answer

The anti-KiSS1 receptor/KISS1R antibody (A01364-1) has not been validated for cross reactivity specifically with bovine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-10-21

Question

Does anti-KiSS1 receptor/KISS1R antibody A01364-1 work for WB with brain?

Verified Customer

Verified customer

Asked: 2019-05-31

Answer

According to the expression profile of brain, KISS1R is highly expressed in brain. So, it is likely that anti-KiSS1 receptor/KISS1R antibody A01364-1 will work for WB with brain.

Boster Scientific Support

Answered: 2019-05-31

Question

I would like to test anti-KiSS1 receptor/KISS1R antibody A01364-1 on mouse brain for research purposes, then I may be interested in using anti-KiSS1 receptor/KISS1R antibody A01364-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

M. Dhar

Verified customer

Asked: 2018-05-08

Answer

The products we sell, including anti-KiSS1 receptor/KISS1R antibody A01364-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2018-05-08

Order DetailsPrice
A01364-1

100μg

$370
A01364-1-10ug

10μg sample (liquid)

$99
A01364-1-Biotin

100 μg Biotin conjugated

$570
A01364-1-Cy3

100 μg Cy3 conjugated

$570
A01364-1-Dylight488

100 μg Dylight488 conjugated

$570
A01364-1-Dylight550

100 μg Dylight550 conjugated

$570
A01364-1-Dylight594

100 μg Dylight594 conjugated

$570
A01364-1-FITC

100 μg FITC conjugated

$570
A01364-1-HRP

100 μg HRP conjugated

$570
A01364-1-APC

100 μg APC conjugated

$670
A01364-1-PE

100 μg PE conjugated

$670
A01364-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
A01364-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.