Anti-Ku70/XRCC6 Antibody Picoband™

Boster Bio Anti-Ku70/XRCC6 Antibody Picoband™ catalog # PB9520. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: PB9520
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IF, IHC-P, ICC, WB

Product Name

Anti-Ku70/XRCC6 Antibody Picoband™

See all Ku70/XRCC6 products

SKU/Catalog Number







Boster Bio Anti-Ku70/XRCC6 Antibody Picoband™ catalog # PB9520. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Ku70/XRCC6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9520)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD), different from the related mouse sequence by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9520 is reactive to XRCC6 in Human


PB9520 is guaranteed for Flow Cytometry, IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For XRCC6 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

X-ray repair cross-complementing protein 6




ku70 family

Alternative Names

5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 70 kDa subunit of Ku antigen; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; D22S731; EC 3.6.4.-; EC 4.2.99.-; G22P1; G22P1Ku70; Ku autoantigen p70 subunit; Ku autoantigen, 70kDa; Ku70; ML8; ML8,70 kDa subunit; thyroid-lupus autoantigen p70; Thyroid-lupus autoantigen; TLAA; TLAAD22S671; X-ray repair complementing defective repair in Chinese hamster cells 6DNA repair protein XRCC6; X-ray repair cross-compleme XRCC6 CTC75, CTCBF, G22P1, KU70, ML8, TLAA X-ray repair cross complementing 6 X-ray repair cross-complementing protein 6|5-dRP lyase Ku70|5-deoxyribose-5-phosphate lyase Ku70|70 kDa subunit of Ku antigen|ATP-dependent DNA helicase 2 subunit 1|ATP-dependent DNA helicase II, 70 kDa subunit|CTC box binding factor 75 kDa subunit|DNA repair protein XRCC6|Ku autoantigen p70 subunit|Ku autoantigen, 70kDa|X-ray repair complementing defective repair in Chinese hamster cells 6|lupus Ku autoantigen protein p70|thyroid autoantigen 70kD (Ku antigen)|thyroid autoantigen 70kDa (Ku antigen)|thyroid-lupus autoantigen p70

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on XRCC6, check out the XRCC6 Infographic

XRCC6 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for XRCC6: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9520

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Ku70/XRCC6 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Ku70/XRCC6 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-Ku70/XRCC6 Antibody Picoband™


We are currently using anti-Ku70/XRCC6 antibody PB9520 for human tissue, and we are well pleased with the ICC results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on dog tissues as well?

P. Brown

Verified customer

Asked: 2017-12-22


The anti-Ku70/XRCC6 antibody (PB9520) has not been tested for cross reactivity specifically with dog tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-12-22



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.