Anti-Musashi 1/Msi1 Antibody Picoband™

Boster Bio Anti-Musashi 1/Msi1 Antibody Picoband™ catalog # A05052-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A05052-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Musashi 1/Msi1 Antibody Picoband™

See all Musashi-1 products

SKU/Catalog Number







Boster Bio Anti-Musashi 1/Msi1 Antibody Picoband™ catalog # A05052-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Musashi 1/Msi1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A05052-1)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

A05052-1 is reactive to MSI1 in Human, Mouse, Rat


A05052-1 is guaranteed for IHC, WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For MSI1 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

RNA-binding protein Musashi homolog 1




Musashi family

Alternative Names

MSI1; Musashi (Drosophila) homolog 1; musashi homolog 1 (Drosophila); Musashi1; Musashi-1; RNA-binding protein Musashi homolog 1 MSI1 musashi RNA binding protein 1 RNA-binding protein Musashi homolog 1|musashi-1|musashi1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on MSI1, check out the MSI1 Infographic

MSI1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for MSI1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A05052-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Musashi 1/Msi1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Musashi 1/Msi1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

12 Customer Q&As for Anti-Musashi 1/Msi1 Antibody Picoband™


We are interested in to test anti-Musashi 1/Msi1 antibody A05052-1 on mouse fetal brain for research purposes, then I may be interested in using anti-Musashi 1/Msi1 antibody A05052-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-03-30


The products we sell, including anti-Musashi 1/Msi1 antibody A05052-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-03-30


Would anti-Musashi 1/Msi1 antibody A05052-1 work on goat IHC with fetal brain?

Verified Customer

Verified customer

Asked: 2020-03-16


Our lab technicians have not validated anti-Musashi 1/Msi1 antibody A05052-1 on goat. You can run a BLAST between goat and the immunogen sequence of anti-Musashi 1/Msi1 antibody A05052-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated goat samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in goat fetal brain in IHC, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-03-16


I see that the anti-Musashi 1/Msi1 antibody A05052-1 works with WB, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2020-02-13


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2020-02-13


We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for fetal brain using anti-Musashi 1/Msi1 antibody A05052-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-09-10


Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-09-10


Is this A05052-1 anti-Musashi 1/Msi1 antibody reactive to the isotypes of MSI1?

Verified Customer

Verified customer

Asked: 2019-07-05


The immunogen of A05052-1 anti-Musashi 1/Msi1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human Musashi 1/Msi1 (21-54aa KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-07-05


See below the WB image, lot number and protocol we used for fetal brain using anti-Musashi 1/Msi1 antibody A05052-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-05-24


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-24


Would A05052-1 anti-Musashi 1/Msi1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-07-13


As indicated on the product datasheet, A05052-1 anti-Musashi 1/Msi1 antibody as been tested on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-07-13


Do you have a BSA free version of anti-Musashi 1/Msi1 antibody A05052-1 available?

S. Parker

Verified customer

Asked: 2018-06-05


Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-Musashi 1/Msi1 antibody A05052-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-06-05


Will anti-Musashi 1/Msi1 antibody A05052-1 work for WB with fetal brain?

Verified Customer

Verified customer

Asked: 2017-06-19


According to the expression profile of fetal brain, MSI1 is highly expressed in fetal brain. So, it is likely that anti-Musashi 1/Msi1 antibody A05052-1 will work for WB with fetal brain.

Boster Scientific Support

Answered: 2017-06-19


I was wanting to use your anti-Musashi 1/Msi1 antibody for WB for mouse fetal brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse fetal brain identification?

Verified Customer

Verified customer

Asked: 2017-06-08


As indicated on the product datasheet, A05052-1 anti-Musashi 1/Msi1 antibody has been validated for IHC, WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse fetal brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-06-08


I have a question about product A05052-1, anti-Musashi 1/Msi1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

D. Krishna

Verified customer

Asked: 2016-06-03


We do not recommend storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A05052-1 anti-Musashi 1/Msi1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2016-06-03


Is a blocking peptide available for product anti-Musashi 1/Msi1 antibody (A05052-1)?

S. Jones

Verified customer

Asked: 2015-05-29


We do provide the blocking peptide for product anti-Musashi 1/Msi1 antibody (A05052-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2015-05-29



Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.