Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™

Ornithine Carbamoyltransferase antibody

Boster Bio Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ catalog # A00721-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00721-1
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™

View all Ornithine Carbamoyltransferase Antibodies

SKU/Catalog Number







Boster Bio Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ catalog # A00721-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00721-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00721-1 is reactive to OTC in Human, Mouse, Rat


A00721-1 is guaranteed for WB Boster Guarantee

Background of Ornithine Carbamoyltransferase

Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For OTC (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Ornithine carbamoyltransferase, mitochondrial




aspartate/ornithine carbamoyltransferase superfamily

Alternative Names

EC 2.1.3; EC; MGC129967; MGC129968; MGC138856; OCTD; Ornithine Carbamoyltransferase; ornithine carbamoyltransferase, mitochondrial; Ornithine Transcarbamylase; OTC; OTCase OTC OCTDD, OTC ornithine transcarbamylase ornithine transcarbamylase, mitochondrial|OTCase|ornithine carbamoyltransferase, mitochondrial

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on OTC, check out the OTC Infographic

OTC infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for OTC: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00721-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™


I was wanting to use your anti-Ornithine Carbamoyltransferase/OTC antibody for WB for human liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human liver identification?

Verified Customer

Verified customer

Asked: 2019-12-13


You can see on the product datasheet, A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human liver in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-12-13


We are currently using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-14


The anti-Ornithine Carbamoyltransferase/OTC antibody (A00721-1) has not been validated for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-14


I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-07-16


We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-16


Please see the WB image, lot number and protocol we used for liver using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-05-30


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-05-30


Is this A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody reactive to the isotypes of OTC?

Verified Customer

Verified customer

Asked: 2018-05-07


The immunogen of A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-05-07


how to order through PO


Total: $315



Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.