Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™

Ornithine Carbamoyltransferase antibody

Boster Bio Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ catalog # A00721-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00721-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™

View all Ornithine Carbamoyltransferase Antibodies

SKU/Catalog Number

A00721-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ catalog # A00721-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00721-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human OTC, different from the related mouse and rat sequences by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00721-1 is reactive to OTC in Human, Mouse, Rat

Applications

A00721-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

40 kDa

Calculated molecular weight

39.935kDa

Background of Ornithine Carbamoyltransferase

Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human

Validation Images & Assay Conditions

Gene/Protein Information For OTC (Source: Uniprot.org, NCBI)

Gene Name

OTC

Full Name

Ornithine carbamoyltransferase, mitochondrial

Weight

39.935kDa

Superfamily

aspartate/ornithine carbamoyltransferase superfamily

Alternative Names

EC 2.1.3; EC 2.1.3.3; MGC129967; MGC129968; MGC138856; OCTD; Ornithine Carbamoyltransferase; ornithine carbamoyltransferase, mitochondrial; Ornithine Transcarbamylase; OTC; OTCase OTC OCTDD, OTC ornithine transcarbamylase ornithine transcarbamylase, mitochondrial|OTCase|ornithine carbamoyltransferase, mitochondrial

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on OTC, check out the OTC Infographic

OTC infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for OTC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00721-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™

Question

I was wanting to use your anti-Ornithine Carbamoyltransferase/OTC antibody for WB for human liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human liver identification?

Verified Customer

Verified customer

Asked: 2019-12-13

Answer

You can see on the product datasheet, A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human liver in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-12-13

Question

We are currently using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-14

Answer

The anti-Ornithine Carbamoyltransferase/OTC antibody (A00721-1) has not been validated for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-14

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-07-16

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-07-16

Question

Please see the WB image, lot number and protocol we used for liver using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2018-05-30

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-05-30

Question

Is this A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody reactive to the isotypes of OTC?

Verified Customer

Verified customer

Asked: 2018-05-07

Answer

The immunogen of A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-05-07

Order DetailsPrice
A00721-1

100μg

$370
A00721-1-10ug

10μg sample (liquid)

$99
A00721-1-Biotin

100 μg Biotin conjugated

$570
A00721-1-Cy3

100 μg Cy3 conjugated

$570
A00721-1-Dylight488

100 μg Dylight488 conjugated

$570
A00721-1-Dylight550

100 μg Dylight550 conjugated

$570
A00721-1-Dylight594

100 μg Dylight594 conjugated

$570
A00721-1-FITC

100 μg FITC conjugated

$570
A00721-1-HRP

100 μg HRP conjugated

$570
A00721-1-APC

100 μg APC conjugated

$670
A00721-1-PE

100 μg PE conjugated

$670
A00721-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
A00721-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.