Product Info Summary
SKU: | A00721-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™
View all Ornithine Carbamoyltransferase Antibodies
SKU/Catalog Number
A00721-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ catalog # A00721-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00721-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human OTC, different from the related mouse and rat sequences by three amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00721-1 is reactive to OTC in Human, Mouse, Rat
Applications
A00721-1 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
40 kDa
Calculated molecular weight
39.935kDa
Background of Ornithine Carbamoyltransferase
Ornithine transcarbamylase (OTC) (also called ornithine carbamoyltransferase) is an enzyme that catalyzes the reaction between carbamoyl phosphate (CP) and ornithine (Orn) to form citrulline (Cit) and phosphate (Pi). This nuclear gene encodes a mitochondrial matrix enzyme. Missense, nonsense, and frameshift mutations in this enzyme lead to ornithine transcarbamylase deficiency, which causes hyperammonemia. Since the gene for this enzyme maps close to that for Duchenne muscular dystrophy, it may also play a role in that disease.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Mouse, Rat, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of OTC using anti-OTC antibody (A00721-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat liver tissue lysates,
Lane 2: mouse liver tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-OTC antigen affinity purified polyclonal antibody (Catalog # A00721-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for OTC at approximately 40KD. The expected band size for OTC is at 40KD.
Protein Target Info & Infographic
Gene/Protein Information For OTC (Source: Uniprot.org, NCBI)
Gene Name
OTC
Full Name
Ornithine carbamoyltransferase, mitochondrial
Weight
39.935kDa
Superfamily
aspartate/ornithine carbamoyltransferase superfamily
Alternative Names
EC 2.1.3; EC 2.1.3.3; MGC129967; MGC129968; MGC138856; OCTD; Ornithine Carbamoyltransferase; ornithine carbamoyltransferase, mitochondrial; Ornithine Transcarbamylase; OTC; OTCase OTC OCTDD, OTC ornithine transcarbamylase ornithine transcarbamylase, mitochondrial|OTCase|ornithine carbamoyltransferase, mitochondrial
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on OTC, check out the OTC Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for OTC: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™ (A00721-1)
Hello CJ!
No publications found for A00721-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
5 Customer Q&As for Anti-Ornithine Carbamoyltransferase/OTC Antibody Picoband™
Question
I was wanting to use your anti-Ornithine Carbamoyltransferase/OTC antibody for WB for human liver on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human liver identification?
Verified Customer
Verified customer
Asked: 2019-12-13
Answer
You can see on the product datasheet, A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human liver in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-12-13
Question
We are currently using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on pig tissues as well?
Verified Customer
Verified customer
Asked: 2019-08-14
Answer
The anti-Ornithine Carbamoyltransferase/OTC antibody (A00721-1) has not been validated for cross reactivity specifically with pig tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-08-14
Question
I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for liver using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1. Let me know if you need anything else.
Verified Customer
Verified customer
Asked: 2019-07-16
Answer
We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2019-07-16
Question
Please see the WB image, lot number and protocol we used for liver using anti-Ornithine Carbamoyltransferase/OTC antibody A00721-1. Please let me know if you require anything else.
Verified Customer
Verified customer
Asked: 2018-05-30
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2018-05-30
Question
Is this A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody reactive to the isotypes of OTC?
Verified Customer
Verified customer
Asked: 2018-05-07
Answer
The immunogen of A00721-1 anti-Ornithine Carbamoyltransferase/OTC antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human OTC (33-70aa NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQK), different from the related mouse and rat sequences by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2018-05-07