Anti-PACE4/PCSK6 Antibody Picoband™

Boster Bio Anti-PACE4/PCSK6 Antibody Picoband™ catalog # PB9769. Tested in WB applications. This antibody reacts with Human, Rat.

Product Info Summary

SKU: PB9769
Size: 100μg/vial
Reactive Species: Human, Rat
Host: Rabbit
Application: WB

Product Name

Anti-PACE4/PCSK6 Antibody Picoband™

See all PACE4/PCSK6 products

SKU/Catalog Number

PB9769

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PACE4/PCSK6 Antibody Picoband™ catalog # PB9769. Tested in WB applications. This antibody reacts with Human, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PACE4/PCSK6 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9769)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE), different from the related rat sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9769 is reactive to PCSK6 in Human, Rat

Applications

PB9769 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Rat

Validation Images & Assay Conditions

Gene/Protein Information For PCSK6 (Source: Uniprot.Org, NCBI)

Uniprot ID

P29122

Gene ID

5046

Gene Name

PCSK6

Full Name

Proprotein convertase subtilisin/kexin type 6

Weight

106.42kDa

Superfamily

peptidase S8 family

Alternative Names

EC 3.4.21; EC 3.4.21.61; EC 3.4.21.75; PACE4; PACE4/PCSK6; PACE4EC 3.4.21.-; Paired basic amino acid cleaving enzyme 4; paired basic amino acid cleaving system 4; PCSK6; Proprotein Convertase 6; proprotein convertase subtilisin/kexin type 6; SPC4; SPC4subtilisin-like protease; Subtilisin/kexin-like protease PACE4; Subtilisin-like proprotein convertase 4 PCSK6 PACE4, SPC4 proprotein convertase subtilisin/kexin type 6 proprotein convertase subtilisin/kexin type 6|paired basic amino acid cleaving enzyme 4|paired basic amino acid cleaving system 4|subtilisin-like proprotein convertase 4|subtilisin/kexin-like protease PACE4

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PCSK6, check out the PCSK6 Infographic

PCSK6 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PCSK6: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9769

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-PACE4/PCSK6 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-PACE4/PCSK6 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-PACE4/PCSK6 Antibody Picoband™

Question

Is a blocking peptide available for product anti-PACE4/PCSK6 antibody (PB9769)?

Verified Customer

Verified customer

Asked: 2020-04-30

Answer

We do provide the blocking peptide for product anti-PACE4/PCSK6 antibody (PB9769). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-04-30

Question

Is there a BSA free version of anti-PACE4/PCSK6 antibody PB9769 available?

Verified Customer

Verified customer

Asked: 2019-12-03

Answer

Thanks for your recent telephone inquiry. I can confirm that some lots of this anti-PACE4/PCSK6 antibody PB9769 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2019-12-03

Question

Thanks for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for hepatoma kidney using anti-PACE4/PCSK6 antibody PB9769. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-11-29

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-11-29

Question

See attached the WB image, lot number and protocol we used for hepatoma kidney using anti-PACE4/PCSK6 antibody PB9769. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-10-11

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-11

Question

We are currently using anti-PACE4/PCSK6 antibody PB9769 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, rat. Is it true that the antibody can work on horse tissues as well?

K. Edwards

Verified customer

Asked: 2019-06-10

Answer

The anti-PACE4/PCSK6 antibody (PB9769) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-06-10

Question

My question regarding product PB9769, anti-PACE4/PCSK6 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-01-04

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9769 anti-PACE4/PCSK6 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-01-04

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9769
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$240.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.