Anti-Peptide YY/PYY Antibody Picoband™

Boster Bio Anti-Peptide YY/PYY Antibody Picoband™ catalog # PB10014. Tested in IHC, WB applications. This antibody reacts with Mouse, Rat.

Product Info Summary

SKU: PB10014
Size: 100μg/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: IHC, WB

Product Name

Anti-Peptide YY/PYY Antibody Picoband™

See all Peptide YY products

SKU/Catalog Number

PB10014

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Peptide YY/PYY Antibody Picoband™ catalog # PB10014. Tested in IHC, WB applications. This antibody reacts with Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Peptide YY/PYY Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10014)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of mouse Peptide YY (29-64aa YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY), different from the related human sequence by three amino acids, and identical to the related rat sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB10014 is reactive to Pyy in Mouse, Rat

Applications

PB10014 is guaranteed for IHC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Mouse
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Mouse, Rat, By Heat

Validation Images & Assay Conditions

Gene/Protein Information For Pyy (Source: Uniprot.Org, NCBI)

Uniprot ID

Q9EPS2

Gene ID

217212

Gene Name

Pyy

Full Name

Peptide YY

Weight

11.064kDa

Superfamily

NPY family

Alternative Names

Peptide tyrosine tyrosine; Peptide YY; Peptide-YY; PYY; PYY1; PYY-I Pyy|peptide YY|peptide YY|Peptide tyrosine tyrosine

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on Pyy, check out the Pyy Infographic

Pyy infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for Pyy: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB10014

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Peptide YY/PYY Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Peptide YY/PYY Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-Peptide YY/PYY Antibody Picoband™

Question

We are currently using anti-Peptide YY/PYY antibody PB10014 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2017-09-06

Answer

The anti-Peptide YY/PYY antibody (PB10014) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-09-06

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB10014
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.