Anti-PKC gamma/PRKCG Antibody Picoband™

PKC gamma antibody

Boster Bio Anti-PKC gamma/PRKCG Antibody Picoband™ catalog # A01890. Tested in ICC/IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Cited in 3 publication(s).

Product Info Summary

SKU: A01890
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IF, IHC, ICC, WB

Product Name

Anti-PKC gamma/PRKCG Antibody Picoband™

View all PKC gamma Antibodies

SKU/Catalog Number

A01890

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-PKC gamma/PRKCG Antibody Picoband™ catalog # A01890. Tested in ICC/IF, IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-PKC gamma/PRKCG Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01890)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence of human PKC gamma/PRKCG (DRLVLASIDQADFQGFTYVNPDFVHPDARS).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01890 is reactive to PRKCG in Human, Mouse, Rat

Applications

A01890 is guaranteed for IF, IHC, ICC, WB Boster Guarantee

Background of PKC gamma

The gamma isotype of protein kinase C (PKC gamma) is a member of the classical PKC (cPKC) subfamily which is activated by Ca (2+) and diacylglycerol in the presence of phosphatidylserine. Physiologically, PKC gamma is activated by a mechanism coupled with receptor-mediated breakdown of inositol phospholipid as other cPKC isotypes such as PKC alpha and PKC beta. PKC gamma is expressed solely in the brain and spinal cord and its localization is restricted to neurons, while PKC alpha and PKC beta are expressed in many tissues in addition to the brain. Within the brain, PKC gamma is the most abundant in the cerebellum, hippocampus and cerebral cortex, where the existence of neuronal plasticity has been demonstrated. PKC gamma gene is mutated in spinocerebellar ataxia type 14 (SCA14). Verbeek et al. (2005) point out the specific alterations in mutant PKC gamma function that could lead to the selective neuronal degeneration of SCA14.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For PRKCG (Source: Uniprot.Org, NCBI)

Uniprot ID

P05129

Gene ID

5582

Gene Name

PRKCG

Full Name

Protein kinase C gamma type

Weight

78.448kDa

Superfamily

protein kinase superfamily

Alternative Names

EC 2.7.11; EC 2.7.11.13; MGC57564; PKC gamma; PKCC; PKCCSCA14; PKCG; PKC-gamma; PKCGprotein kinase C gamma type; PRKCG; protein kinase C, gamma; SCA14 PRKCG PKC-gamma, PKCC, PKCG, PKCI(3), PKCgamma, SCA14 protein kinase C gamma protein kinase C gamma type

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PRKCG, check out the PRKCG Infographic

PRKCG infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PRKCG: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

A01890 has been cited in 3 publications:

*The publications in this section are manually curated by our staff scientists. They may differ from Bioz's machine gathered results. Both are accurate. If you find a publication citing this product but is missing from this list, please let us know we will issue you a thank-you coupon.

5-(Bis(3-(2-hydroxyethyl)-1H-indol-2-yl)methyl)-2-hydroxybenzoic acid (BHIMHA): showing a strategy of designing drug to block lung metastasis of tumors

5-(Bis(3-(2-hydroxyethyl)-1H-indol-2-yl)methyl)-2-hydroxybenzoic acid (BHIMHA): showing a strategy of designing drug to block lung metastasis of tumors

Extracts from Salvia-Nelumbinis naturalis alleviate hepatosteatosis via improving hepatic insulin sensitivity

Have you used Anti-PKC gamma/PRKCG Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-PKC gamma/PRKCG Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

6 Customer Q&As for Anti-PKC gamma/PRKCG Antibody Picoband™

Question

Will A01890 anti-PKC gamma/PRKCG antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2020-04-29

Answer

You can see on the product datasheet, A01890 anti-PKC gamma/PRKCG antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2020-04-29

Question

Is this A01890 anti-PKC gamma/PRKCG antibody reactive to the isotypes of PRKCG?

S. Huang

Verified customer

Asked: 2019-12-25

Answer

The immunogen of A01890 anti-PKC gamma/PRKCG antibody is A synthetic peptide corresponding to a sequence of human PKC gamma/PRKCG (DRLVLASIDQADFQGFTYVNPDFVHPDARS). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-12-25

Question

My question regards to test anti-PKC gamma/PRKCG antibody A01890 on rat brain for research purposes, then I may be interested in using anti-PKC gamma/PRKCG antibody A01890 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-05-13

Answer

The products we sell, including anti-PKC gamma/PRKCG antibody A01890, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-05-13

Question

We are currently using anti-PKC gamma/PRKCG antibody A01890 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2018-02-09

Answer

The anti-PKC gamma/PRKCG antibody (A01890) has not been tested for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-02-09

Question

I see that the anti-PKC gamma/PRKCG antibody A01890 works with WB, what is the protocol used to produce the result images on the product page?

R. Brown

Verified customer

Asked: 2014-04-03

Answer

You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2014-04-03

Question

My question regarding product A01890, anti-PKC gamma/PRKCG antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

E. Rodriguez

Verified customer

Asked: 2013-12-11

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01890 anti-PKC gamma/PRKCG antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2013-12-11

Conjugation

how to order through PO

Size

Total: $315

Size:100μg

SKU:A01890

Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!

ELISA Kits

ELISA Kits

More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.

Image

Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit

Reagents

Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
A01890
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$315.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.