Anti-SHP2/PTPN11 Antibody Picoband™ (monoclonal, 2E6)

Boster Bio Anti-SHP2/PTPN11 Antibody Picoband™ (monoclonal, 2E6) catalog # M00150-2. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: M00150-2
Size: 100μg/vial
Reactive Species: Human, Mouse, Rat
Host: Mouse
Application: Flow Cytometry, IF, IHC-P, ICC, WB

Product Name

Anti-SHP2/PTPN11 Antibody Picoband™ (monoclonal, 2E6)

See all SHP-2/PTPN11 products

SKU/Catalog Number







Boster Bio Anti-SHP2/PTPN11 Antibody Picoband™ (monoclonal, 2E6) catalog # M00150-2. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SHP2/PTPN11 Antibody Picoband™ (monoclonal, 2E6) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00150-2)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.



Clone Number





A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

M00150-2 is reactive to PTPN11 in Human, Mouse, Rat


M00150-2 is guaranteed for Flow Cytometry, IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500μg/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
Immunocytochemistry/Immunofluorescence, 2μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For PTPN11 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Tyrosine-protein phosphatase non-receptor type 11




protein-tyrosine phosphatase family

Alternative Names

BPTP3; EC; MGC14433; protein tyrosine phosphatase, non-receptor type 11; protein tyrosine phosphatase-2; Protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; PTP1D; PTP-1D; PTP2C; PTP-2C; PTP2CNS1; PTPN11; SHP2; SHP-2; SHP2CFC; SHPTP2; SH-PTP2; SH-PTP2Noonan syndrome 1; SH-PTP3; tyrosine-protein phosphatase non-receptor type 11 PTPN11 BPTP3, CFC, JMML, METCDS, NS1, PTP-1D, PTP2C, SH-PTP2, SH-PTP3, SHP2 protein tyrosine phosphatase non-receptor type 11 tyrosine-protein phosphatase non-receptor type 11|SH2 domain-containing protein tyrosine phosphatase 2|protein-tyrosine phosphatase 1D|protein-tyrosine phosphatase 2C

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on PTPN11, check out the PTPN11 Infographic

PTPN11 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for PTPN11: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for M00150-2

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SHP2/PTPN11 Antibody Picoband™ (monoclonal, 2E6)?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SHP2/PTPN11 Antibody Picoband™ (monoclonal, 2E6)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for Anti-SHP2/PTPN11 Antibody Picoband™ (monoclonal, 2E6)


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.