Anti-SLC7A3 Antibody Picoband™

CAT3/SLC7A3 antibody

Boster Bio Anti-SLC7A3 Antibody Picoband™ catalog # A09720-1. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A09720-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-SLC7A3 Antibody Picoband™

View all CAT3/SLC7A3 Antibodies

SKU/Catalog Number

A09720-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SLC7A3 Antibody Picoband™ catalog # A09720-1. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SLC7A3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A09720-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3, different from the related mouse and rat sequences by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A09720-1 is reactive to Slc7a3 in Human

Applications

A09720-1 is guaranteed for WB Boster Guarantee

Observed Molecular Weight

67 kDa

Calculated molecular weight

67.46kDa

Background of CAT3/SLC7A3

Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For Slc7a3 (Source: Uniprot.org, NCBI)

Gene Name

Slc7a3

Full Name

Cationic amino acid transporter 3

Weight

67.46kDa

Superfamily

amino acid-polyamine-organocation (APC) superfamily

Alternative Names

ATRC3; ATRC3cationic amino acid transporter 3; CAT3; CAT-3Cationic amino acid transporter y+; FLJ14541; MGC20687; SLC7A3; solute carrier family 7 (cationic amino acid transporter, y+ system), member 3; Solute carrier family 7 member 3 Slc7a3|Atr, Atrc3, CAT-3, CAT3, Cat, SLC, SLC7A1, SLC7A2|solute carrier family 7 (cationic amino acid transporter, y+ system), member 3|cationic amino acid transporter 3|amino acid transporter, cationic 3|cationic amino acid transporter y+|solute carrier family 7 member 3

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on Slc7a3, check out the Slc7a3 Infographic

Slc7a3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for Slc7a3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A09720-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SLC7A3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SLC7A3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-SLC7A3 Antibody Picoband™

Question

Is a blocking peptide available for product anti-SLC7A3 antibody (A09720-1)?

Verified Customer

Verified customer

Asked: 2020-02-11

Answer

We do provide the blocking peptide for product anti-SLC7A3 antibody (A09720-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-02-11

Question

Is this A09720-1 anti-SLC7A3 antibody reactive to the isotypes of SLC7A3?

Verified Customer

Verified customer

Asked: 2020-02-04

Answer

The immunogen of A09720-1 anti-SLC7A3 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-02-04

Question

We are currently using anti-SLC7A3 antibody A09720-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-24

Answer

The anti-SLC7A3 antibody (A09720-1) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-24

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cauda epididymis using anti-SLC7A3 antibody A09720-1. Let me know if you need anything else.

A. Patel

Verified customer

Asked: 2016-05-16

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-05-16

Order DetailsPrice
A09720-1

100μg

$370
A09720-1-10ug

10μg sample (liquid)

$99
A09720-1-Biotin

100 μg Biotin conjugated

$570
A09720-1-Cy3

100 μg Cy3 conjugated

$570
A09720-1-Dylight488

100 μg Dylight488 conjugated

$570
A09720-1-Dylight550

100 μg Dylight550 conjugated

$570
A09720-1-Dylight594

100 μg Dylight594 conjugated

$570
A09720-1-FITC

100 μg FITC conjugated

$570
A09720-1-HRP

100 μg HRP conjugated

$570
A09720-1-APC

100 μg APC conjugated

$670
A09720-1-PE

100 μg PE conjugated

$670
A09720-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
A09720-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.