Anti-SLC7A3 Antibody Picoband®

SLC7A3 antibody

Boster Bio Anti-SLC7A3 Antibody Picoband® catalog # A09720-1. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A09720-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Customers Who Bought This Also Bought

Product Name

Anti-SLC7A3 Antibody Picoband®

View all SLC7A3 Antibodies

SKU/Catalog Number

A09720-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SLC7A3 Antibody Picoband® catalog # A09720-1. Tested in WB applications. This antibody reacts with Human. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SLC7A3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A09720-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3, different from the related mouse and rat sequences by four amino acids.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A09720-1 is reactive to SLC7A3 in Human

Observed Molecular Weight

67 kDa

Calculated molecular weight

67.2 kDa

Background of SLC7A3

Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A09720-1 is guaranteed for WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman

Tested application

SLC7A3 antibody was positively detected by WB in:
human A431 whole cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-SLC7A3 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-SLC7A3 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-SLC7A3 Antibody Picoband®

Question

Is a blocking peptide available for product anti-SLC7A3 antibody (A09720-1)?

Verified Customer

Verified customer

Asked: 2020-02-11

Answer

We do provide the blocking peptide for product anti-SLC7A3 antibody (A09720-1). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2020-02-11

Question

Is this A09720-1 anti-SLC7A3 antibody reactive to the isotypes of SLC7A3?

Verified Customer

Verified customer

Asked: 2020-02-04

Answer

The immunogen of A09720-1 anti-SLC7A3 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-02-04

Question

We are currently using anti-SLC7A3 antibody A09720-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on goat tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-24

Answer

The anti-SLC7A3 antibody (A09720-1) has not been validated for cross reactivity specifically with goat tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-24

Question

Thank you for helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cauda epididymis using anti-SLC7A3 antibody A09720-1. Let me know if you need anything else.

A. Patel

Verified customer

Asked: 2016-05-16

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-05-16

Order DetailsPrice
A09720-1

100μg

$370
A09720-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A09720-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A09720-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A09720-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A09720-1-APC

100 μg APC conjugated (liquid)

$820
A09720-1-FITC

100 μg FITC conjugated (liquid)

$570
A09720-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A09720-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A09720-1-HRP

100 μg HRP conjugated (liquid)

$570
A09720-1-PE

100 μg PE conjugated (liquid)

$820
A09720-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A09720-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Jun 8, 2026