Anti-SMC3 Antibody Picoband®

SMC3 antibody

Boster Bio Anti-SMC3 Antibody Picoband® catalog # PB9746. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB9746
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-SMC3 Antibody Picoband®

View all SMC3 Antibodies

SKU/Catalog Number

PB9746

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SMC3 Antibody Picoband® catalog # PB9746. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SMC3 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9746)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3, identical to the related mouse sequence.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9746 is reactive to SMC3 in Human, Mouse, Rat

Observed Molecular Weight

140 kDa

Calculated molecular weight

141.5 kDa

Background of SMC3

Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9746 is guaranteed for IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman, Mouse, Rat
Western blot0.1-0.5μg/mlHuman, Mouse, Rat

Tested application

SMC3 antibody was positively detected by WB in:
Rat Brain Tissue, Rat Liver Tissue, Rat Testis Tissue, HELA Whole Cell, A549 Whole Cell, MCF-7 Whole Cell, NIH3T3 Whole Cell
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
SMC3 antibody was positively detected by IHC in:
mouse intestine tissue, rat kidney tissue, human intestinal cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-SMC3 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-SMC3 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-SMC3 Antibody Picoband®

Question

We are currently using anti-SMC3 antibody PB9746 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on canine tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-24

Answer

The anti-SMC3 antibody (PB9746) has not been tested for cross reactivity specifically with canine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-24

Question

Is there a BSA free version of anti-SMC3 antibody PB9746 available?

Verified Customer

Verified customer

Asked: 2020-03-06

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SMC3 antibody PB9746 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-03-06

Question

Is this PB9746 anti-SMC3 antibody reactive to the isotypes of SMC3?

Verified Customer

Verified customer

Asked: 2019-10-16

Answer

The immunogen of PB9746 anti-SMC3 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-16

Question

Please see the WB image, lot number and protocol we used for brain using anti-SMC3 antibody PB9746. Please let me know if you require anything else.

C. Lewis

Verified customer

Asked: 2015-11-23

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-11-23

Order DetailsPrice
PB9746

100μg

$370
PB9746-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9746-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9746-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9746-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9746-APC

100 μg APC conjugated (liquid)

$820
PB9746-FITC

100 μg FITC conjugated (liquid)

$570
PB9746-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9746-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9746-HRP

100 μg HRP conjugated (liquid)

$570
PB9746-PE

100 μg PE conjugated (liquid)

$820
PB9746-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9746
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 13, 2026