Anti-SMC3 Antibody Picoband™

SMC3 antibody

Boster Bio Anti-SMC3 Antibody Picoband™ catalog # PB9746. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9746
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-SMC3 Antibody Picoband™

View all SMC3 Antibodies

SKU/Catalog Number

PB9746

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SMC3 Antibody Picoband™ catalog # PB9746. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SMC3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9746)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3, identical to the related mouse sequence.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB9746 is reactive to SMC3 in Human, Mouse, Rat

Applications

PB9746 is guaranteed for IHC, WB Boster Guarantee

Observed Molecular Weight

140 kDa

Calculated molecular weight

141.542kDa

Background of SMC3

Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For SMC3 (Source: Uniprot.org, NCBI)

Gene Name

SMC3

Full Name

Structural maintenance of chromosomes protein 3

Weight

141.542kDa

Superfamily

SMC family

Alternative Names

Bamacan; BAMSMC protein 3; Basement membrane-associated chondroitin proteoglycan; BMH; chondroitin sulfate proteoglycan 6 (bamacan); Chondroitin sulfate proteoglycan 6; Chromosome-associated polypeptide; CSPG6structural maintenance of chromosomes protein 3; hCAP; HCAPbamacan; SMC-3; SMC3L1CDLS3; structural maintenance of chromosomes 3 SMC3 BAM, BMH, CDLS3, CSPG6, HCAPL1, SMC3 structural maintenance of chromosomes 3 structural maintenance of chromosomes protein 3|SMC protein 3|basement membrane-associated chondroitin proteoglycan|chondroitin sulfate proteoglycan 6 (bamacan)|chromosome-associated polypeptide

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on SMC3, check out the SMC3 Infographic

SMC3 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for SMC3: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB9746

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SMC3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SMC3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-SMC3 Antibody Picoband™

Question

We are currently using anti-SMC3 antibody PB9746 for rat tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it possible that the antibody can work on canine tissues as well?

Verified Customer

Verified customer

Asked: 2020-03-24

Answer

The anti-SMC3 antibody (PB9746) has not been tested for cross reactivity specifically with canine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-03-24

Question

Is there a BSA free version of anti-SMC3 antibody PB9746 available?

Verified Customer

Verified customer

Asked: 2020-03-06

Answer

I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-SMC3 antibody PB9746 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-03-06

Question

Is this PB9746 anti-SMC3 antibody reactive to the isotypes of SMC3?

Verified Customer

Verified customer

Asked: 2019-10-16

Answer

The immunogen of PB9746 anti-SMC3 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-16

Question

Please see the WB image, lot number and protocol we used for brain using anti-SMC3 antibody PB9746. Please let me know if you require anything else.

C. Lewis

Verified customer

Asked: 2015-11-23

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2015-11-23

Order DetailsPrice
PB9746

100μg

$370
PB9746-10ug

10μg sample (liquid)

$99
PB9746-Biotin

100 μg Biotin conjugated

$570
PB9746-Cy3

100 μg Cy3 conjugated

$570
PB9746-Dylight488

100 μg Dylight488 conjugated

$570
PB9746-Dylight550

100 μg Dylight550 conjugated

$570
PB9746-Dylight594

100 μg Dylight594 conjugated

$570
PB9746-FITC

100 μg FITC conjugated

$570
PB9746-HRP

100 μg HRP conjugated

$570
PB9746-APC

100 μg APC conjugated

$670
PB9746-PE

100 μg PE conjugated

$670
PB9746-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
Eddy test
In stock
Order Product
PB9746
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.