Overview
Product Name |
Anti-SRY Antibody Picoband™
See more SRY products |
Catalog# |
A00614-1 |
Pack Size |
100ug/vial |
Storage & Handling |
Store at -20°C for one year. For short term storage and frequent use, store at 4°C for up to one month. Avoid repeated freeze-thaw cycles. |
Description |
Boster Bio Anti-SRY Antibody Picoband™ catalog # A00614-1. Tested in WB applications. This antibody reacts with Human. Supplied as 100ug/vial in Lyophilized form antibody. |
Cite This Product |
Anti-SRY Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00614-1)
|
Antibodies Validation |
Antibodies Validation Information
|
Similar Products From Other Companies |
Anti-SRY Antibody Picoband™ may replace the following items: sc 33168|sc 8235|sc 33169|sc 69842|sc 374224|sc 8234|sc 8233|sc 33169 X|sc 398567 X|sc 398567|sc 8232 R|sc 8232 X|sc 33168 X|sc 374224 X|sc 8234 R|sc 8234 X|sc 8235 X|sc 8233 X. |
Product Specs
Host |
Rabbit |
Reactive Species |
Human |
Applications |
WB
*Our Boster Guarantee covers the use of this product in the above
tested applications.
*Innovating Scientists reward: if you test this antibody on a species or application not listed above and share with us your results, we will provide you a full credit to purchase Boster products. |
Related Products |
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
*Blocking peptide can be purchased at $100. Contact us for more information.
**Boster also offers various secondary antibodies for Immunoflourescecne and IHC. Take advantage of the buy 1 primary antibody get 1 secondary antibody for free promotion all year round. |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR). |
Cross Reactivity |
No cross reactivity with other proteins. |
Gene/Protein Basic Information For SRY (Source: Uniprot.org, NCBI)
Uniprot Id | Q05066 |
---|
NCBI Gene Id | 6736 |
---|
Species Of This Entry | Human |
---|
Gene Name | SRY |
---|
Protein Name | Sex-determining region Y protein |
---|
Superfamily | SRY family |
---|
Alternative Names | SRY|essential protein for sex determination in human males; sex determining region Y; sex-determining region on Y; sex-determining region Y protein; TDFsex determining region protein; TDY; Testis-determining factor |
---|
Molecular Weight | 23884 |
---|
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".
For more info on SRY, check out the SRY Infographic
We have 30,000+ of these available, one for each gene! Check them out.
Want a nice infographic on your next protein? Boster's got them all. All proteins in the human genome, and some, can be found in the Boster Bio gene infographics. Download it and share it with your colleagues and friends. Big size posters available upon request.
In this infographic you will see the following information for SRY: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. Some times it even contains some opt-ed articles the Boster team on the scientific news and clinical impacts of this protein, though not all have that. Too many proteins, you know.
Take me to the SRY infographic
Our Boster Quality Guarantee for Anti-SRY Antibody Picoband™ covers its use in the following applications.
Western blot, 0.1-0.5μg/ml, Human
*The recommended dilution ratios/concentrations are for reference only and optimal dilutions/concentrations should be determined by the end user.

Figure 1. Western blot analysis of SRY using anti-SRY antibody (A00614-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SRY antigen affinity purified polyclonal antibody (Catalog # A00614-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SRY at approximately 26KD. The expected band size for SRY is at 24KD.
Specific Protocols
Boster provides comprehensive technical information for WB, IHC/IF/ICC, Flow Cytometry sample preparation protocols, assay protocols, troubleshooting tips and assay optimization tips.
Did You Know ?
That Boster Bio offers comprehensive selection of Western blot and IHC reagents? Great quality and save up to 50% cost.
Other Recommended Resources
Here are featured tools and databases that you might find useful.
Total number of citations: 0
|
0 reviews
Contact us with any questions at [email protected] or go to contact us
Questions and answers from customers related to A00614-1 Anti-SRY Antibody Picoband™
5 Related Questions
Question
My question regards to test anti-SRY antibody A00614-1 on human skin of abdomen for research purposes, then I may be interested in using anti-SRY antibody A00614-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?
Verified Customer
Asked: 2019-11-07
Answer
The products we sell, including anti-SRY antibody A00614-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.
Boster Scientific Support
Answered: 2019-11-07
Question
I was wanting to use your anti-SRY antibody for WB for human skin of abdomen on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human skin of abdomen identification?
Verified Customer
Asked: 2019-06-13
Answer
It shows on the product datasheet, A00614-1 anti-SRY antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human skin of abdomen in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2019-06-13
Question
We are currently using anti-SRY antibody A00614-1 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on monkey tissues as well?
Verified Customer
Asked: 2019-05-20
Answer
The anti-SRY antibody (A00614-1) has not been tested for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-05-20
Question
Will anti-SRY antibody A00614-1 work for WB with skin of abdomen?
O. Johnson
Asked: 2019-02-06
Answer
According to the expression profile of skin of abdomen, SRY is highly expressed in skin of abdomen. So, it is likely that anti-SRY antibody A00614-1 will work for WB with skin of abdomen.
Boster Scientific Support
Answered: 2019-02-06
Question
Is this A00614-1 anti-SRY antibody reactive to the isotypes of SRY?
J. Miller
Asked: 2013-12-30
Answer
The immunogen of A00614-1 anti-SRY antibody is A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2013-12-30