Anti-SRY Antibody Picoband™

Product Name

Anti-SRY Antibody Picoband™

See all SRY products

SKU/Catalog Number

A00614-1

Size

100ug/vial

Form

Lyophilized

Description

Boster Bio Anti-SRY Antibody Picoband™ catalog # A00614-1. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SRY Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00614-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR).

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00614-1 is reactive to SRY in Human

Applications

A00614-1 is guaranteed for WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Click image to see more details

Figure 1. Western blot analysis of SRY using anti-SRY antibody (A00614-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysate.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SRY antigen affinity purified polyclonal antibody (Catalog # A00614-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SRY at approximately 26KD. The expected band size for SRY is at 24KD.

Gene/Protein Information For SRY (Source: Uniprot.Org, NCBI)

Alternative Names

essential protein for sex determination in human males; sex determining region Y; sex-determining region on Y; sex-determining region Y protein; TDFsex determining region protein; TDY; Testis-determining factor SRY SRXX1, SRXY1, TDF, TDY sex determining region Y sex-determining region Y protein|essential protein for sex determination in human males|sex-determining region on Y|testis-determining factor on Y|truncated sex-determining region Y protein

For more info on SRY, check out the SRY Infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for SRY: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

Take me to the SRY Infographic

Here are featured tools and databases that you might find useful.

• Boster's Pathways Library
• Protein Databases
• Bioscience Research Protocol Resources
• Data Processing & Analysis Software
• Photo Editing Software
• Scientific Literature Resources
• Research Paper Management Tools
• Molecular Biology Software
• Primer Design Tools
• Bioinformatics Tools
• Phylogenetic Tree Analysis