Anti-SRY Antibody Picoband™

Boster Bio Anti-SRY Antibody Picoband™ catalog # A00614-1. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A00614-1
Size: 100ug/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-SRY Antibody Picoband™

See all SRY products

SKU/Catalog Number







Boster Bio Anti-SRY Antibody Picoband™ catalog # A00614-1. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SRY Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00614-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR).

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A00614-1 is reactive to SRY in Human


A00614-1 is guaranteed for WB Boster Guarantee

*Blocking peptide can be purchased at $150. Contact us for more information.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human

Validation Images & Assay Conditions

Gene/Protein Information For SRY (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Sex-determining region Y protein




SRY family

Alternative Names

essential protein for sex determination in human males; sex determining region Y; sex-determining region on Y; sex-determining region Y protein; TDFsex determining region protein; TDY; Testis-determining factor SRY SRXX1, SRXY1, TDF, TDY sex determining region Y sex-determining region Y protein|essential protein for sex determination in human males|sex-determining region on Y|testis-determining factor on Y|truncated sex-determining region Y protein

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on SRY, check out the SRY Infographic

SRY infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for SRY: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A00614-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SRY Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-SRY Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

5 Customer Q&As for Anti-SRY Antibody Picoband™


My question regards to test anti-SRY antibody A00614-1 on human skin of abdomen for research purposes, then I may be interested in using anti-SRY antibody A00614-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-11-07


The products we sell, including anti-SRY antibody A00614-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-11-07


I was wanting to use your anti-SRY antibody for WB for human skin of abdomen on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human skin of abdomen identification?

Verified Customer

Verified customer

Asked: 2019-06-13


It shows on the product datasheet, A00614-1 anti-SRY antibody has been tested for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human skin of abdomen in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-06-13


We are currently using anti-SRY antibody A00614-1 for human tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on monkey tissues as well?

Verified Customer

Verified customer

Asked: 2019-05-20


The anti-SRY antibody (A00614-1) has not been tested for cross reactivity specifically with monkey tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-05-20


Will anti-SRY antibody A00614-1 work for WB with skin of abdomen?

O. Johnson

Verified customer

Asked: 2019-02-06


According to the expression profile of skin of abdomen, SRY is highly expressed in skin of abdomen. So, it is likely that anti-SRY antibody A00614-1 will work for WB with skin of abdomen.

Boster Scientific Support

Answered: 2019-02-06


Is this A00614-1 anti-SRY antibody reactive to the isotypes of SRY?

J. Miller

Verified customer

Asked: 2013-12-30


The immunogen of A00614-1 anti-SRY antibody is A synthetic peptide corresponding to a sequence in the middle region of human SRY (90-130aa ISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYR). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2013-12-30


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.