Product Info Summary
SKU: | A03222-3 |
---|---|
Size: | 100μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | ELISA, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Thrombopoietin/THPO Antibody Picoband™
View all Thrombopoietin/THPO Antibodies
SKU/Catalog Number
A03222-3
Size
100μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Thrombopoietin/THPO Antibody Picoband™ catalog # A03222-3. Tested in ELISA, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Thrombopoietin/THPO Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03222-3)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Immunogen
A synthetic peptide corresponding to a sequence of human Thrombopoietin/THPO (DFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQL).
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross Reactivity
No cross reactivity with other proteins.
Reactive Species
A03222-3 is reactive to THPO in Human, Mouse, Rat
Applications
A03222-3 is guaranteed for ELISA, WB Boster Guarantee
Background of Thrombopoietin/THPO
Thrombopoietin (THPO), also known as megakaryocyte growth and development factor (MGDF), is a protein that in humans is encoded by the THPO gene. Megakaryocytopoiesis is the cellular development process that leads to platelet production. The main functional protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Mutations in this gene are the cause of thrombocythemia 1. Alternative promoter usage and differential splicing result in multiple transcript variants differing in the 5' UTR and/or coding region. Multiple AUG codons upstream of the main open reading frame (ORF) have been identified, and these upstream AUGs inhibit translation of the main ORF at different extent.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists world wide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
ELISA, 1-5μg/ml
Validation Images & Assay Conditions

Click image to see more details
Figure 1. Western blot analysis of Thrombopoietin using anti-Thrombopoietin antibody (A03222-3).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human HepG2 whole cell lysate,
Lane 2: human Caco-2 whole cell lysate,
Lane 3: rat liver tissue lysate,
Lane 4: mouse liver tissue lysate,
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Thrombopoietin antigen affinity purified polyclonal antibody (Catalog # A03222-3) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Thrombopoietin at approximately 38KD. The expected band size for Thrombopoietin is at 38KD.
Protein Target Info & Infographic
Gene/Protein Information For THPO (Source: Uniprot.Org, NCBI)
Uniprot ID
P40225
Gene ID
7066
Gene Name
THPO
Full Name
Thrombopoietin
Weight
37.823kDa
Superfamily
EPO/TPO family
Alternative Names
Megakaryocyte colony-stimulating factor; Megakaryocyte growth and development factor; megakaryocyte stimulating factor; MGDF; MGDFC-mpl ligand; MKCSF; MK-CSF; ML; MPL ligand; MPLLG; MPLLGMGC163194; Myeloproliferative leukemia virus oncogene ligand; THCYT1; THPO; thrombopoietin nirs variant 1; Thrombopoietin; Tpo; TPOMKCSF THPO MGDF, MKCSF, ML, MPLLG, THCYT1, TPO thrombopoietin thrombopoietin|MPL ligand|c-mpl ligand|megakaryocyte colony-stimulating factor|megakaryocyte growth and development factor|megakaryocyte stimulating factor|myeloproliferative leukemia virus oncogene ligand|prepro-thrombopoietin
*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".For more info on THPO, check out the THPO Infographic

We have 30,000+ of these available, one for each gene! check them out.
In this infographic you will see the following information for THPO: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]
Specific Publications For Anti-Thrombopoietin/THPO Antibody Picoband™ (A03222-3)
No publications found for A03222-3
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Thrombopoietin/THPO Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Submit A Review
Be the first to review Anti-Thrombopoietin/THPO Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question