Anti-TSLP Antibody Picoband™

Boster Bio Anti-TSLP Antibody Picoband™ catalog # A01096-1. Tested in WB applications. This antibody reacts with Mouse, Rat.

Product Info Summary

SKU: A01096-1
Size: 100ug/vial
Reactive Species: Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-TSLP Antibody Picoband™

See all Tslp products

SKU/Catalog Number







Boster Bio Anti-TSLP Antibody Picoband™ catalog # A01096-1. Tested in WB applications. This antibody reacts with Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TSLP Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A01096-1)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A01096-1 is reactive to Tslp in Mouse, Rat


A01096-1 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For Tslp (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Thymic stromal lymphopoietin



Alternative Names

thymic stromal lymphopoietin; TSLP Tslp|thymic stromal lymphopoietin|thymic stromal lymphopoietin|thymic stroma-derived lymphopoietin

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on Tslp, check out the Tslp Infographic

Tslp infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for Tslp: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A01096-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-TSLP Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-TSLP Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-TSLP Antibody Picoband™


Our lab were content with the WB result of your anti-TSLP antibody. However we have seen positive staining in lung testis secreted. using this antibody. Is that expected? Could you tell me where is TSLP supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-04-20


According to literature, lung testis does express TSLP. Generally TSLP expresses in secreted. Regarding which tissues have TSLP expression, here are a few articles citing expression in various tissues:
Brain, Lung, and Testis, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2020-04-20


Do you have a BSA free version of anti-TSLP antibody A01096-1 available?

Verified Customer

Verified customer

Asked: 2020-03-10


Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-TSLP antibody A01096-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-03-10


We are currently using anti-TSLP antibody A01096-1 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says mouse, rat. Is it possible that the antibody can work on monkey tissues as well?

T. Parker

Verified customer

Asked: 2020-02-20


The anti-TSLP antibody (A01096-1) has not been validated for cross reactivity specifically with monkey tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in monkey you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-02-20


Will anti-TSLP antibody A01096-1 work on horse WB with brain?

Verified Customer

Verified customer

Asked: 2019-11-13


Our lab technicians have not tested anti-TSLP antibody A01096-1 on horse. You can run a BLAST between horse and the immunogen sequence of anti-TSLP antibody A01096-1 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated horse samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in horse brain in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-11-13


Will A01096-1 anti-TSLP antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

M. Li

Verified customer

Asked: 2019-11-01


As indicated on the product datasheet, A01096-1 anti-TSLP antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-11-01


I was wanting to use your anti-TSLP antibody for WB for rat epithelial cell of pancreas on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for rat epithelial cell of pancreas identification?

S. Li

Verified customer

Asked: 2019-07-03


It shows on the product datasheet, A01096-1 anti-TSLP antibody has been validated for WB on mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in rat epithelial cell of pancreas in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2019-07-03


Is this A01096-1 anti-TSLP antibody reactive to the isotypes of TSLP?

Verified Customer

Verified customer

Asked: 2018-03-23


The immunogen of A01096-1 anti-TSLP antibody is A synthetic peptide corresponding to a sequence of mouse TSLP (QEMAQEVQNICLNQTSQILRLWYSFMQSPE). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2018-03-23


Is a blocking peptide available for product anti-TSLP antibody (A01096-1)?

Verified Customer

Verified customer

Asked: 2018-03-13


We do provide the blocking peptide for product anti-TSLP antibody (A01096-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-03-13


I see that the anti-TSLP antibody A01096-1 works with WB, what is the protocol used to produce the result images on the product page?

R. Li

Verified customer

Asked: 2018-02-14


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-02-14


Would anti-TSLP antibody A01096-1 work for WB with epithelial cell of pancreas?

V. Rodriguez

Verified customer

Asked: 2017-09-06


According to the expression profile of epithelial cell of pancreas, TSLP is highly expressed in epithelial cell of pancreas. So, it is likely that anti-TSLP antibody A01096-1 will work for WB with epithelial cell of pancreas.

Boster Scientific Support

Answered: 2017-09-06


Here is the WB image, lot number and protocol we used for epithelial cell of pancreas using anti-TSLP antibody A01096-1. Please let me know if you require anything else.

C. Anderson

Verified customer

Asked: 2016-06-14


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-06-14


I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for epithelial cell of pancreas using anti-TSLP antibody A01096-1. Let me know if you need anything else.

O. Wu

Verified customer

Asked: 2016-06-09


Thank you for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-06-09


We have observed staining in rat lung testis. Do you have any suggestions? Is anti-TSLP antibody supposed to stain lung testis positively?

V. Thomas

Verified customer

Asked: 2014-07-21


Based on literature lung testis does express TSLP. Based on, TSLP is expressed in epithelial cell of pancreas, brain, lung testis, among other tissues. Regarding which tissues have TSLP expression, here are a few articles citing expression in various tissues:
Brain, Lung, and Testis, Pubmed ID: 15489334

Boster Scientific Support

Answered: 2014-07-21


I have a question about product A01096-1, anti-TSLP antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

K. Jones

Verified customer

Asked: 2013-01-22


We suggest not storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A01096-1 anti-TSLP antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2013-01-22


We want to test anti-TSLP antibody A01096-1 on rat epithelial cell of pancreas for research purposes, then I may be interested in using anti-TSLP antibody A01096-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

E. Gonzalez

Verified customer

Asked: 2013-01-11


The products we sell, including anti-TSLP antibody A01096-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2013-01-11


Total: $315

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.