Anti-TUB 1 Antibody Picoband™

Tubby antibody

Boster Bio Anti-TUB 1 Antibody Picoband™ catalog # A02917-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A02917-1
Size: 100 μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, WB

Product Name

Anti-TUB 1 Antibody Picoband™

View all Tubby Antibodies

SKU/Catalog Number

A02917-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-TUB 1 Antibody Picoband™ catalog # A02917-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-TUB 1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A02917-1)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1, different from the related mouse and rat sequences by one amino acid.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A02917-1 is reactive to TUB in Human

Applications

A02917-1 is guaranteed for Flow Cytometry, WB Boster Guarantee

Observed Molecular Weight

62 kDa

Calculated molecular weight

55.651kDa

Background of Tubby

Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For TUB (Source: Uniprot.org, NCBI)

Gene Name

TUB

Full Name

Tubby protein homolog

Weight

55.651kDa

Superfamily

TUB family

Alternative Names

RD5; RDOB; tubby (mouse) homolog; tubby homolog (mouse); Tubby Homolog; tubby homologue; tubby protein homolog; Tubby TUB RDOB, rd5 TUB bipartite transcription factor tubby protein homolog|tubby bipartite transcription factor|tubby homolog|tubby homologue

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on TUB, check out the TUB Infographic

TUB infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for TUB: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A02917-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-TUB 1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For Anti-TUB 1 Antibody Picoband™

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-TUB 1 Antibody Picoband™

Question

Is this A02917-1 anti-TUB 1 antibody reactive to the isotypes of TUB?

Verified Customer

Verified customer

Asked: 2019-09-13

Answer

The immunogen of A02917-1 anti-TUB 1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human TUB 1 (395-429aa VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-09-13

Question

I was wanting to use to test anti-TUB 1 antibody A02917-1 on human fetal brain for research purposes, then I may be interested in using anti-TUB 1 antibody A02917-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-07-22

Answer

The products we sell, including anti-TUB 1 antibody A02917-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-07-22

Question

We are currently using anti-TUB 1 antibody A02917-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2017-08-09

Answer

The anti-TUB 1 antibody (A02917-1) has not been validated for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2017-08-09

Question

I was wanting to use your anti-TUB 1 antibody for WB for human fetal brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human fetal brain identification?

S. Edwards

Verified customer

Asked: 2014-02-27

Answer

As indicated on the product datasheet, A02917-1 anti-TUB 1 antibody has been validated for Flow Cytometry, WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human fetal brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2014-02-27

Order DetailsPrice
A02917-1

100μg

$370
A02917-1-10ug

10μg sample (liquid)

$99
A02917-1-Biotin

100 μg Biotin conjugated

$570
A02917-1-Cy3

100 μg Cy3 conjugated

$570
A02917-1-Dylight488

100 μg Dylight488 conjugated

$570
A02917-1-Dylight550

100 μg Dylight550 conjugated

$570
A02917-1-Dylight594

100 μg Dylight594 conjugated

$570
A02917-1-FITC

100 μg FITC conjugated

$570
A02917-1-HRP

100 μg HRP conjugated

$570
A02917-1-APC

100 μg APC conjugated

$670
A02917-1-PE

100 μg PE conjugated

$670
A02917-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A02917-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.