Anti-UHRF1 Antibody Picoband™

Boster Bio Anti-UHRF1 Antibody Picoband™ catalog # PB9905. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human.

Product Info Summary

SKU: PB9905
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: Flow Cytometry, IF, IHC-P, ICC, WB

Product Name

Anti-UHRF1 Antibody Picoband™

See all UHRF1 products

SKU/Catalog Number

PB9905

Size

100μg/vial

Form

Lyophilized

Description

Boster Bio Anti-UHRF1 Antibody Picoband™ catalog # PB9905. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-UHRF1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9905)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

PB9905 is reactive to UHRF1 in Human

Applications

PB9905 is guaranteed for Flow Cytometry, IF, IHC-P, ICC, WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For UHRF1 (Source: Uniprot.Org, NCBI)

Uniprot ID

Q96T88

Gene ID

29128

Gene Name

UHRF1

Full Name

E3 ubiquitin-protein ligase UHRF1

Weight

89.814kDa

Alternative Names

E3 ubiquitin-protein ligase UHRF1; EC 6.3.2; EC 6.3.2.-; FLJ21925; hNP95; huNp95; ICBP90NP95; Inverted CCAAT box-binding protein of 90 kDa; Np95; Nuclear protein 95; Nuclear zinc finger protein Np95; RING finger protein 106; RNF106MGC138707; Transcription factor ICBP90; Ubiquitin-like PHD and RING finger domain-containing protein 1; ubiquitin-like with PHD and ring finger domains 1; ubiquitin-like, containing PHD and RING finger domains, 1; Ubiquitin-like-containing PHD and RING finger domains protein 1 UHRF1 ICBP90, Np95, RNF106, TDRD22, hNP95, hUHRF1, huNp95 ubiquitin like with PHD and ring finger domains 1 E3 ubiquitin-protein ligase UHRF1|RING finger protein 106|RING-type E3 ubiquitin transferase UHRF1|inverted CCAAT box-binding protein of 90 kDa|nuclear phosphoprotein 95|nuclear protein 95|nuclear zinc finger protein Np95|transcription factor ICBP90|ubiquitin-like PHD and RING finger domain-containing protein 1

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on UHRF1, check out the UHRF1 Infographic

UHRF1 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for UHRF1: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for PB9905

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-UHRF1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-UHRF1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-UHRF1 Antibody Picoband™

Question

Does anti-UHRF1 antibody PB9905 work on goat WB with cervix carcinoma?

Verified Customer

Verified customer

Asked: 2020-04-27

Answer

Our lab technicians have not validated anti-UHRF1 antibody PB9905 on goat. You can run a BLAST between goat and the immunogen sequence of anti-UHRF1 antibody PB9905 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated goat samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in goat cervix carcinoma in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-27

Question

Do you have a BSA free version of anti-UHRF1 antibody PB9905 available?

Verified Customer

Verified customer

Asked: 2020-04-08

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-UHRF1 antibody PB9905 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2020-04-08

Question

I am looking for to test anti-UHRF1 antibody PB9905 on human cervix carcinoma erythroleukemia for research purposes, then I may be interested in using anti-UHRF1 antibody PB9905 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2020-03-10

Answer

The products we sell, including anti-UHRF1 antibody PB9905, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2020-03-10

Question

We are currently using anti-UHRF1 antibody PB9905 for human tissue, and we are satisfied with the ICC results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on bovine tissues as well?

Verified Customer

Verified customer

Asked: 2018-12-13

Answer

The anti-UHRF1 antibody (PB9905) has not been tested for cross reactivity specifically with bovine tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in bovine you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2018-12-13

Question

Is a blocking peptide available for product anti-UHRF1 antibody (PB9905)?

Verified Customer

Verified customer

Asked: 2018-05-15

Answer

We do provide the blocking peptide for product anti-UHRF1 antibody (PB9905). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-05-15

Question

Does anti-UHRF1 antibody PB9905 work for WB with cervix carcinoma erythroleukemia?

S. Zhao

Verified customer

Asked: 2015-06-11

Answer

According to the expression profile of cervix carcinoma erythroleukemia, UHRF1 is highly expressed in cervix carcinoma erythroleukemia. So, it is likely that anti-UHRF1 antibody PB9905 will work for WB with cervix carcinoma erythroleukemia.

Boster Scientific Support

Answered: 2015-06-11

Question

My question regarding product PB9905, anti-UHRF1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

B. Yang

Verified customer

Asked: 2013-08-29

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9905 anti-UHRF1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2013-08-29

Conjugation

Size

Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
PB9905
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$280.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.