Anti-UNC5C Antibody Picoband™

UNC5H3/UNC5C antibody

Boster Bio Anti-UNC5C Antibody Picoband™ catalog # PB9841. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB9841
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: WB

Product Name

Anti-UNC5C Antibody Picoband™

View all UNC5H3/UNC5C Antibodies

SKU/Catalog Number



100 μg/vial




Boster Bio Anti-UNC5C Antibody Picoband™ catalog # PB9841. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-UNC5C Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9841)




Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




Rabbit IgG


A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins

Reactive Species

PB9841 is reactive to UNC5C in Human, Mouse, Rat


PB9841 is guaranteed for WB Boster Guarantee

Background of UNC5H3/UNC5C

Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review


Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat

Validation Images & Assay Conditions

Gene/Protein Information For UNC5C (Source:, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Netrin receptor UNC5C




unc-5 family

Alternative Names

netrin receptor UNC5C; Protein unc-5 homolog 3; Protein unc-5 homolog C; unc-5 homolog 3; unc-5 homolog C (C. elegans); UNC5C; UNC5H3; UNC5H3unc5 (C.elegans homolog) c UNC5C UNC5H3 unc-5 netrin receptor C netrin receptor UNC5C|protein unc-5 homolog 3|protein unc-5 homolog C|unc-5 homolog 3|unc-5 homolog C|unc5 (C.elegans homolog) c

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on UNC5C, check out the UNC5C Infographic

UNC5C infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for UNC5C: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected]

No publications found for PB9841

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-UNC5C Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-UNC5C Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-UNC5C Antibody Picoband™


Will anti-UNC5C antibody PB9841 work for WB with lung?

G. Zhao

Verified customer

Asked: 2019-11-21


According to the expression profile of lung, UNC5C is highly expressed in lung. So, it is likely that anti-UNC5C antibody PB9841 will work for WB with lung.

Boster Scientific Support

Answered: 2019-11-21


Please see the WB image, lot number and protocol we used for lung using anti-UNC5C antibody PB9841. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-10-17


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-10-17


Does PB9841 anti-UNC5C antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2018-12-25


As indicated on the product datasheet, PB9841 anti-UNC5C antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2018-12-25


I was wanting to use your anti-UNC5C antibody for WB for mouse lung on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for mouse lung identification?

Verified Customer

Verified customer

Asked: 2017-06-14


It shows on the product datasheet, PB9841 anti-UNC5C antibody has been validated for WB on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in mouse lung in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-06-14


We are currently using anti-UNC5C antibody PB9841 for human tissue, and we are satisfied with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on horse tissues as well?

C. Krishna

Verified customer

Asked: 2015-12-01


The anti-UNC5C antibody (PB9841) has not been validated for cross reactivity specifically with horse tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in horse you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2015-12-01


Is this PB9841 anti-UNC5C antibody reactive to the isotypes of UNC5C?

W. Jones

Verified customer

Asked: 2014-02-19


The immunogen of PB9841 anti-UNC5C antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2014-02-19


Will anti-UNC5C antibody PB9841 work on goat WB with brain?

D. Jones

Verified customer

Asked: 2013-04-01


Our lab technicians have not validated anti-UNC5C antibody PB9841 on goat. You can run a BLAST between goat and the immunogen sequence of anti-UNC5C antibody PB9841 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated goat samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in goat brain in WB, you can get your next antibody for free.

Boster Scientific Support

Answered: 2013-04-01



Total: $315


Ask a question

Get A Quote

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

Product Categories

Primary Antibodies

Primary and Secondary Antibodies

Boster Bio offers over 16,000 antibodies that have been validated for IHC, WB, ELISA, and FC in human, mouse, and rat samples. Rabbit and mouse monoclonal antibodies as well as rabbit polyclonal antibodies are available. Buy a primary antibody and get a secondary antibody for free!



More than 1,000 ELISA kits, both singleplex and multiplex, that have been cited 6,000+ times are available at Boster. We offer our Boster-branded Picokine™ ELISA kits (sandwich ELISA) and EZ-Set™ ELISA kits (DIY antibody pairs) in addition to many multiplex ELISA kits.


Recombinant Proteins

Boster provides a wide range of human, mouse, and rat recombinant proteins, which include cytokines, growth factors, chemokines, and many more. Our recombinant proteins have high stability, biological activity, and purity.

Boster Kit


Boster offers all the reagents you need for your immunostaining and western blotting experiments. We've got everything from buffers to lysates to kits, including our popular and well-cited BCA, CCK-8, and MTT assay kits.

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)

$50 fee for conjugation. Antibody size is reduced to 50ug.



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.