Anti-ZP3 Antibody Picoband™

Boster Bio Anti-ZP3 Antibody Picoband™ catalog # A03543-1. Tested in WB applications. This antibody reacts with Human.

Product Info Summary

SKU: A03543-1
Size: 100μg/vial
Reactive Species: Human
Host: Rabbit
Application: WB

Product Name

Anti-ZP3 Antibody Picoband™

See all ZP3 products

SKU/Catalog Number







Boster Bio Anti-ZP3 Antibody Picoband™ catalog # A03543-1. Tested in WB applications. This antibody reacts with Human.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ZP3 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A03543-1)




Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.




A synthetic peptide corresponding to a sequence of human ZP3 (LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT).

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross Reactivity

No cross reactivity with other proteins.

Reactive Species

A03543-1 is reactive to ZP3 in Human


A03543-1 is guaranteed for WB Boster Guarantee

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence and ELISA with known positive and negative samples to ensure specificity and high affinity.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive your next antibody/ELISA kit free of charge! Applicable to all scientists world wide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. Actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml

Validation Images & Assay Conditions

Gene/Protein Information For ZP3 (Source: Uniprot.Org, NCBI)

Uniprot ID


Gene ID


Gene Name


Full Name

Zona pellucida sperm-binding protein 3




ZP domain family

Alternative Names

zona pellucida glycoprotein 3 (sperm receptor) ZP3 OOMD3A, ZP3B, ZPC, Zp-3, ZP3 zona pellucida glycoprotein 3 zona pellucida sperm-binding protein 3|ZP3A/ZP3B|sperm receptor|zona pellucida glycoprotein 3B|zona pellucida glycoprotein ZP3|zona pellucida protein C

*if product is indicated to react with multiple species, protein info is based on the gene entry specified above in "species".

For more info on ZP3, check out the ZP3 Infographic

ZP3 infographic

We have 30,000+ of these available, one for each gene! check them out.

In this infographic you will see the following information for ZP3: database IDs, super-family, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us [email protected]

No publications found for A03543-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ZP3 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ZP3 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives a free antibody. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-ZP3 Antibody Picoband™


Is a blocking peptide available for product anti-ZP3 antibody (A03543-1)?

Verified Customer

Verified customer

Asked: 2020-02-21


We do provide the blocking peptide for product anti-ZP3 antibody (A03543-1). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-02-21


Our lab were content with the WB result of your anti-ZP3 antibody. However we have seen positive staining in lung processed zona pellucida sperm-binding using this antibody. Is that expected? Could you tell me where is ZP3 supposed to be expressed?

Verified Customer

Verified customer

Asked: 2020-02-11


Based on literature, lung does express ZP3. Generally ZP3 expresses in processed zona pellucida sperm-binding, cell membrane. Regarding which tissues have ZP3 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Lung, Pubmed ID: 14702039
Ovary, Pubmed ID: 1478648

Boster Scientific Support

Answered: 2020-02-11


Does anti-ZP3 antibody A03543-1 work for WB with brain?

Verified Customer

Verified customer

Asked: 2020-01-21


According to the expression profile of brain, ZP3 is highly expressed in brain. So, it is likely that anti-ZP3 antibody A03543-1 will work for WB with brain.

Boster Scientific Support

Answered: 2020-01-21


We are currently using anti-ZP3 antibody A03543-1 for human tissue, and we are well pleased with the WB results. The species of reactivity given in the datasheet says human. Is it true that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-02


The anti-ZP3 antibody (A03543-1) has not been validated for cross reactivity specifically with zebrafish tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-02


I have a question about product A03543-1, anti-ZP3 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2019-11-07


It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A03543-1 anti-ZP3 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2019-11-07


I am looking for to test anti-ZP3 antibody A03543-1 on human brain for research purposes, then I may be interested in using anti-ZP3 antibody A03543-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-09-13


The products we sell, including anti-ZP3 antibody A03543-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-09-13


Here is the WB image, lot number and protocol we used for brain using anti-ZP3 antibody A03543-1. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-08-19


Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-08-19


We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for brain using anti-ZP3 antibody A03543-1. Let me know if you need anything else.

E. Banerjee

Verified customer

Asked: 2019-04-09


We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-09


Do you have a BSA free version of anti-ZP3 antibody A03543-1 available?

D. Roberts

Verified customer

Asked: 2018-06-06


I appreciate your recent telephone inquiry. I can confirm that some lots of this anti-ZP3 antibody A03543-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-06-06


We have observed staining in human ovary. What should we do? Is anti-ZP3 antibody supposed to stain ovary positively?

Verified Customer

Verified customer

Asked: 2018-05-02


From literature ovary does express ZP3. From, ZP3 is expressed in lower esophagus mucosa, ovary, lung, brain, among other tissues. Regarding which tissues have ZP3 expression, here are a few articles citing expression in various tissues:
Brain, Pubmed ID: 15489334
Lung, Pubmed ID: 14702039
Ovary, Pubmed ID: 1478648

Boster Scientific Support

Answered: 2018-05-02


I am interested in using your anti-ZP3 antibody for negative regulation of binding of sperm to zona pellucida studies. Has this antibody been tested with western blotting on human placenta tissue? We would like to see some validation images before ordering.

Verified Customer

Verified customer

Asked: 2018-02-22


We appreciate your inquiry. This A03543-1 anti-ZP3 antibody is validated on human placenta tissue, hela whole cell lysates, a549 whole cell lysates, u2os whole cell lysates. It is guaranteed to work for WB in human. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2018-02-22


I was wanting to use your anti-ZP3 antibody for WB for human brain on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human brain identification?

Verified Customer

Verified customer

Asked: 2018-01-19


As indicated on the product datasheet, A03543-1 anti-ZP3 antibody has been validated for WB on human tissues. We have an innovator award program that if you test this antibody and show it works in human brain in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2018-01-19


Is this A03543-1 anti-ZP3 antibody reactive to the isotypes of ZP3?

C. Johnson

Verified customer

Asked: 2015-12-15


The immunogen of A03543-1 anti-ZP3 antibody is A synthetic peptide corresponding to a sequence of human ZP3(LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2015-12-15


I see that the anti-ZP3 antibody A03543-1 works with WB, what is the protocol used to produce the result images on the product page?

R. Carter

Verified customer

Asked: 2014-02-28


You can find protocols for WB on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2014-02-28


Would A03543-1 anti-ZP3 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

R. Evans

Verified customer

Asked: 2013-09-04


You can see on the product datasheet, A03543-1 anti-ZP3 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2013-09-04


Ask a question

Ships directly to USA and Canada. For other regions, visit our distributors page

Bulk Inquiry

Sample Inquiry

In stock
Order Product
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)



Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.