ATP6V1G2 (NM_138282) Human Recombinant Protein

ATP6V1G2 protein,

Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2 (ATP6V1G2), transcript variant 2

Product Info Summary

SKU: PROTO95670
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

ATP6V1G2 (NM_138282) Human Recombinant Protein

View all ATP6V1G2 recombinant proteins

SKU/Catalog Number

PROTO95670

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2 (ATP6V1G2), transcript variant 2

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Cite This Product

ATP6V1G2 (NM_138282) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO95670)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

13.604kDa

Amino Acid Sequence

MEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Validation Images & Assay Conditions

Gene/Protein Information For ATP6V1G2 (Source: Uniprot.org, NCBI)

Gene Name

ATP6V1G2

Full Name

V-type proton ATPase subunit G 2

Weight

13.604kDa

Superfamily

V-ATPase G subunit family

Alternative Names

ATP6G2; ATPase, H+ transporting, lysosomal (vacuolar proton pump); ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 2; ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2; Em:AC004181.3; subunit G2; vacuolar ATP synthase subunit G 2; vacuolar proton pump G subunit 2; Vacuolar proton pump subunit G 2; V-ATPase 13 kDa subunit 2; V-ATPase subunit G 2; Vma10; V-type proton ATPase subunit G 2 ATP6V1G2 ATP6G, ATP6G2, NG38, VMA10 ATPase H+ transporting V1 subunit G2 V-type proton ATPase subunit G 2|ATPase, H+ transporting, lysosomal (vacuolar proton pump)|ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2|H(+)-transporting two-sector ATPase, subunit G2|V-ATPase 13 kDa subunit 2|vacuolar ATP synthase subunit G 2|vacuolar proton pump G subunit 2

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on ATP6V1G2, check out the ATP6V1G2 Infographic

ATP6V1G2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ATP6V1G2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO95670

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used ATP6V1G2 (NM_138282) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review ATP6V1G2 (NM_138282) Human Recombinant Protein

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for ATP6V1G2 (NM_138282) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO95670
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.