NDUFS4 (NM_002495) Human Recombinant Protein

NDUFS4 protein,

Product Info Summary

SKU: PROTO43181
Size: 20 µg
Source: HEK293T

Customers Who Bought This Also Bought

Product Name

NDUFS4 (NM_002495) Human Recombinant Protein

View all NDUFS4 recombinant proteins

SKU/Catalog Number

PROTO43181

Size

20 µg

Tag

C-Myc/DDK

Description

Recombinant protein of human NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) (NDUFS4), nuclear gene encoding mitochondrial protein

Storage & Handling

Store at -80°C. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. (Ship on dry ice.)

Cite This Product

NDUFS4 (NM_002495) Human Recombinant Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # PROTO43181)

Form

Frozen Solution in PBS Buffer

Formulation

25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol

Concentration

>50 ug/mL as determined by microplate BCA method

Purity

> 80% as determined by SDS-PAGE and Coomassie blue staining

Predicted MW

15.3 kDa

Amino Acid Sequence

MAAVSMSVVLRQTLWRRRAVAVAALSVSRVPTRSLRTSSWRLAQDQTQDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK

Validation Images & Assay Conditions

Gene/Protein Information For NDUFS4 (Source: Uniprot.org, NCBI)

Gene Name

NDUFS4

Full Name

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

Weight

15.3 kDa

Superfamily

complex I NDUFS4 subunit family

Alternative Names

AQDQ; AQDQmitochondrial; CI-18 kDa; NADH dehydrogenase (ubiquinone) Fe-S protein 4 (18kD) (NADH-coenzyme Qreductase); NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Qreductase); NADH-coenzyme Q reductase, 18-KD; NADH-ubiquinone oxidoreductase 18 kDa subunit NDUFS4 AQDQ, CI-18, CI-18 kDa, CI-AQDQ, MC1DN1 NADH:ubiquinone oxidoreductase subunit S4 NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial|NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)|NADH-ubiquinone oxidoreductase 18 kDa subunit|complex I 18kDa subunit|complex I-AQDQ|mitochondrial respiratory chain complex I (18-KD subunit)

*If product is indicated to react with multiple species, protein information is based on the gene entry specified above in "Species".

For more info on NDUFS4, check out the NDUFS4 Infographic

NDUFS4 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for NDUFS4: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact us at [email protected].

Hello CJ!

No publications found for PROTO43181

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used NDUFS4 (NM_002495) Human Recombinant Protein?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

0 Reviews For NDUFS4 (NM_002495) Human Recombinant Protein

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

0 Customer Q&As for NDUFS4 (NM_002495) Human Recombinant Protein

$1249
Backordered.

Lead time for this item is typically 2 weeks

Get A Quote
In stock
Order Product
PROTO43181
$1,249.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.