Anti-L1CAM Antibody

L1CAM antibody

Boster Bio Anti-L1CAM Antibody catalog # A00729-1. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat. Cited in 1 publication(s).

Product Info Summary

SKU: A00729-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: IHC

Customers Who Bought This Also Bought

Product Name

Anti-L1CAM Antibody

View all L1CAM Antibodies

SKU/Catalog Number

A00729-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-L1CAM Antibody catalog # A00729-1. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-L1CAM Antibody (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00729-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human L1CAM, which shares 88.2% and 82.4% amino acid (aa) sequence identity with mouse and rat L1CAM, respectively.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00729-1 is reactive to L1CAM in Human, Mouse, Rat

Calculated molecular weight

140.0 kDa

Background of L1CAM

L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00729-1 is guaranteed for IHC Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/ml

Tested application

L1CAM antibody was positively detected by IHC in:
mouse brain tissue, mouse brain tissue, rat brain tissue, human colon cancer tissue, human glioma tissue, human lung cancer tissue, human mammary cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-L1CAM Antibody?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-L1CAM Antibody

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

15 Customer Q&As for Anti-L1CAM Antibody

Question

Will anti-L1CAM antibody A00729-1 work for IHC with cervix carcinoma?

Verified Customer

Verified customer

Asked: 2020-04-08

Answer

According to the expression profile of cervix carcinoma, L1CAM is highly expressed in cervix carcinoma. So, it is likely that anti-L1CAM antibody A00729-1 will work for IHC with cervix carcinoma.

Boster Scientific Support

Answered: 2020-04-08

Question

Is this A00729-1 anti-L1CAM antibody reactive to the isotypes of L1CAM?

Verified Customer

Verified customer

Asked: 2019-06-26

Answer

The immunogen of A00729-1 anti-L1CAM antibody is A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW). Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-06-26

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for cervix carcinoma using anti-L1CAM antibody A00729-1. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2019-04-12

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-04-12

Question

Is a blocking peptide available for product anti-L1CAM antibody (A00729-1)?

Verified Customer

Verified customer

Asked: 2018-12-26

Answer

We do provide the blocking peptide for product anti-L1CAM antibody (A00729-1). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2018-12-26

Question

I see that the anti-L1CAM antibody A00729-1 works with IHC, what is the protocol used to produce the result images on the product page?

Verified Customer

Verified customer

Asked: 2018-12-26

Answer

You can find protocols for IHC on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to support@bosterbio.com

Boster Scientific Support

Answered: 2018-12-26

Question

Do you have a BSA free version of anti-L1CAM antibody A00729-1 available?

L. Zhang

Verified customer

Asked: 2018-12-11

Answer

Thank you for your recent telephone inquiry. I can confirm that some lots of this anti-L1CAM antibody A00729-1 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2018-12-11

Question

I was wanting to use your anti-L1CAM antibody for IHC for human cervix carcinoma on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human cervix carcinoma identification?

R. Singh

Verified customer

Asked: 2017-09-26

Answer

As indicated on the product datasheet, A00729-1 anti-L1CAM antibody has been validated for IHC on human, mouse, rat tissues. We have an innovator award program that if you test this antibody and show it works in human cervix carcinoma in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2017-09-26

Question

We are interested in to test anti-L1CAM antibody A00729-1 on human cervix carcinoma for research purposes, then I may be interested in using anti-L1CAM antibody A00729-1 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2017-06-02

Answer

The products we sell, including anti-L1CAM antibody A00729-1, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2017-06-02

Question

Our team were satisfied with the WB result of your anti-L1CAM antibody. However we have been able to see positive staining in cervix carcinoma cell membrane using this antibody. Is that expected? Could you tell me where is L1CAM supposed to be expressed?

J. Krishna

Verified customer

Asked: 2016-12-21

Answer

From what I have seen in literature, cervix carcinoma does express L1CAM. Generally L1CAM expresses in cell membrane. Regarding which tissues have L1CAM expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231, 23186163
Fetal brain, Pubmed ID: 1769655, 1923824, 1932117
Liver, Pubmed ID: 19159218
Pancreas, Pubmed ID: 15489334
Plasma, Pubmed ID: 16335952

Boster Scientific Support

Answered: 2016-12-21

Question

We are currently using anti-L1CAM antibody A00729-1 for mouse tissue, and we are happy with the IHC results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on goat tissues as well?

L. Wu

Verified customer

Asked: 2016-10-25

Answer

The anti-L1CAM antibody (A00729-1) has not been validated for cross reactivity specifically with goat tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in goat you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2016-10-25

Question

We have observed staining in mouse fetal brain. What should we do? Is anti-L1CAM antibody supposed to stain fetal brain positively?

D. Edwards

Verified customer

Asked: 2016-05-31

Answer

Based on literature fetal brain does express L1CAM. Based on Uniprot.org, L1CAM is expressed in right hemisphere of cerebellum, fetal brain, pancreas, plasma, cervix carcinoma, liver, among other tissues. Regarding which tissues have L1CAM expression, here are a few articles citing expression in various tissues:
Cervix carcinoma, Pubmed ID: 17081983, 18669648, 20068231, 23186163
Fetal brain, Pubmed ID: 1769655, 1923824, 1932117
Liver, Pubmed ID: 19159218
Pancreas, Pubmed ID: 15489334
Plasma, Pubmed ID: 16335952

Boster Scientific Support

Answered: 2016-05-31

Question

Does A00729-1 anti-L1CAM antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

M. Krishna

Verified customer

Asked: 2016-01-25

Answer

You can see on the product datasheet, A00729-1 anti-L1CAM antibody as been tested on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2016-01-25

Question

I have attached the WB image, lot number and protocol we used for cervix carcinoma using anti-L1CAM antibody A00729-1. Please let me know if you require anything else.

J. Lewis

Verified customer

Asked: 2014-07-29

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2014-07-29

Question

I am looking for using your anti-L1CAM antibody for axon development studies. Has this antibody been tested with western blotting on colon cancer tissue? We would like to see some validation images before ordering.

B. Taylor

Verified customer

Asked: 2013-08-29

Answer

Thanks for your inquiry. This A00729-1 anti-L1CAM antibody is validated on mouse brain, brain tissue, rat brain tissue, human glioma tissue, colon cancer tissue, lung cancer tissue, mammary cancer tissue. It is guaranteed to work for IHC in human, mouse, rat. Our Boster guarantee will cover your intended experiment even if the sample type has not been be directly tested.

Boster Scientific Support

Answered: 2013-08-29

Question

Can you help my question with product A00729-1, anti-L1CAM antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

N. Zhang

Verified customer

Asked: 2013-04-15

Answer

It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free A00729-1 anti-L1CAM antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2013-04-15

Order DetailsPrice
A00729-1

100μg

$370
A00729-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A00729-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A00729-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A00729-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A00729-1-APC

100 μg APC conjugated (liquid)

$820
A00729-1-FITC

100 μg FITC conjugated (liquid)

$570
A00729-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A00729-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A00729-1-HRP

100 μg HRP conjugated (liquid)

$570
A00729-1-PE

100 μg PE conjugated (liquid)

$820
A00729-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00729-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Jun 10, 2026