Anti-SUR1/ABCC8 Antibody Picoband®

ABCC8 antibody

Boster Bio Anti-SUR1/ABCC8 Antibody Picoband® catalog # A00895-1. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: A00895-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Customers Who Bought This Also Bought

Product Name

Anti-SUR1/ABCC8 Antibody Picoband®

View all ABCC8 Antibodies

SKU/Catalog Number

A00895-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SUR1/ABCC8 Antibody Picoband® catalog # A00895-1. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SUR1/ABCC8 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00895-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human SUR1, which shares 97.7% amino acid (aa) sequence identity with both mouse and rat SUR1.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00895-1 is reactive to ABCC8 in Human, Mouse, Rat

Observed Molecular Weight

177 kDa

Calculated molecular weight

177.0 kDa

Background of ABCC8

ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

A00895-1 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/ml
Immunohistochemistry (Frozen Section)0.5-1μg/ml
Immunocytochemistry0.5-1μg/ml
Flow Cytometry (Fixed)1-3μg/1x106 cells

Tested application

SUR1 antibody was positively detected by WB in:
human placenta tissue, rat brain tissue, mouse brain tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
SUR1 antibody was positively detected by FC in:
A431 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-SUR1/ABCC8 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-SUR1/ABCC8 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-SUR1/ABCC8 Antibody Picoband®

Question

Is the epitope on the extracellular side of the membrane or intracellular?

Verified customer

Asked: 2020-09-25

Answer

The immunogen sequence of A00895-1 is 906-948aa TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA, which is located in cytoplasmic region. https://www.uniprot.org/uniprot/Q09428#sequences

Boster Scientific Support

Answered: 2020-09-26

Order DetailsPrice
A00895-1

100μg

$370
A00895-1-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
A00895-1-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
A00895-1-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
A00895-1-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
A00895-1-APC

100 μg APC conjugated (liquid)

$820
A00895-1-FITC

100 μg FITC conjugated (liquid)

$570
A00895-1-Cy3

100 μg Cy3 conjugated (liquid)

$570
A00895-1-Biotin

100 μg Biotin conjugated (liquid)

$570
A00895-1-HRP

100 μg HRP conjugated (liquid)

$570
A00895-1-PE

100 μg PE conjugated (liquid)

$820
A00895-1-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00895-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Jun 15, 2026