Product Info Summary
| SKU: | PB10033 |
|---|---|
| Size: | 100 μg/vial |
| Reactive Species: | Human, Mouse, Rat |
| Host: | Rabbit |
| Application: | Flow Cytometry, IHC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Adenylate Kinase 1/AK1 Antibody Picoband®
SKU/Catalog Number
PB10033
PB1082 is an alternative SKU for this antibody, used in previous lots.
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Adenylate Kinase 1/AK1 Antibody Picoband® catalog # PB10033. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Adenylate Kinase 1/AK1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10033)
Host
Rabbit
Contents
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Adenylate Kinase 1, different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB10033 is reactive to AK1 in Human, Mouse, Rat
Observed Molecular Weight
22 kDa
Calculated molecular weight
21.6 kDa
Background of AK1
This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Application & Images
Applications
PB10033 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee
Recommend Dilution
| Application | Dilution | Species |
|---|---|---|
| Western Blot (WB) | 0.1-0.5μg/ml | Human, Mouse, Rat |
| Immunohistochemistry (IHC) | 2-5μg/ml | Human, Mouse, Rat |
| Flow Cytometry (FC) | 1-3μg/1x106 cells | Human |
Tested application
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
Validation Images & Assay Conditions
Click image to see more details
Western blot analysis of AK1 using anti-AK1 antibody (PB10033).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: human Hela whole cell lysates,
Lane 2: human SiHa whole cell lysates,
Lane 3: rat heart tissue lysates,
Lane 4: mouse lung tissue lysates,
Lane 5: mouse heart tissue lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-AK1 antigen affinity purified polyclonal antibody (Catalog # PB10033) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for AK1 at approximately 22 kDa. The expected band size for AK1 is at 22 kDa.
Click image to see more details
IHC analysis of AK1 using anti-AK1 antibody (PB10033).
AK1 was detected in a paraffin-embedded section of human colon cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-AK1 Antibody (PB10033) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
IHC analysis of AK1 using anti-AK1 antibody (PB10033).
AK1 was detected in a paraffin-embedded section of human lung adenocarcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-AK1 Antibody (PB10033) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
IHC analysis of AK1 using anti-AK1 antibody (PB10033).
AK1 was detected in a paraffin-embedded section of mouse heart tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-AK1 Antibody (PB10033) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
IHC analysis of AK1 using anti-AK1 antibody (PB10033).
AK1 was detected in a paraffin-embedded section of rat heart tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2 μg/ml rabbit anti-AK1 Antibody (PB10033) overnight at 4°C. Peroxidase Conjugated Goat Anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using HRP Conjugated Rabbit IgG Super Vision Assay Kit (Catalog # SV0002) with DAB as the chromogen.
Click image to see more details
Flow Cytometry analysis of PC-3 cells using anti-AK1 antibody (PB10033).
Overlay histogram showing PC-3 cells stained with PB10033 (Blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-AK1 Antibody (PB10033, 1 μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10 μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1 μg/1x106) used under the same conditions. Unlabelled sample without incubation with primary antibody and secondary antibody (Red line) was used as a blank control.
Specific Publications For Anti-Adenylate Kinase 1/AK1 Antibody Picoband® (PB10033)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Adenylate Kinase 1/AK1 Antibody Picoband®?
Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.
0 Reviews For Anti-Adenylate Kinase 1/AK1 Antibody Picoband®
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Adenylate Kinase 1/AK1 Antibody Picoband®
Question
Is this PB10033 anti-Adenylate Kinase 1/AK1 antibody reactive to the isotypes of AK1?
Verified Customer
Verified customer
Asked: 2020-04-29
Answer
The immunogen of PB10033 anti-Adenylate Kinase 1/AK1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-29
Question
Is a blocking peptide available for product anti-Adenylate Kinase 1/AK1 antibody (PB10033)?
Verified Customer
Verified customer
Asked: 2020-02-17
Answer
We do provide the blocking peptide for product anti-Adenylate Kinase 1/AK1 antibody (PB10033). If you would like to place an order for it please contact support@bosterbio.com and make a special request.
Boster Scientific Support
Answered: 2020-02-17
Question
We are currently using anti-Adenylate Kinase 1/AK1 antibody PB10033 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-21
Answer
The anti-Adenylate Kinase 1/AK1 antibody (PB10033) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-21
Question
I have attached the WB image, lot number and protocol we used for erythroleukemia using anti-Adenylate Kinase 1/AK1 antibody PB10033. Please let me know if you require anything else.
H. Parker
Verified customer
Asked: 2016-08-10
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-08-10


