Anti-liver FABP/FABP1 Antibody Picoband®

FABP1 antibody

Boster Bio Anti-liver FABP/FABP1 Antibody Picoband® catalog # PB9586. Tested in IHC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat, Chicken. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance. Cited in 2 publication(s).

Product Info Summary

SKU: PB9586
Size: 100 μg/vial
Reactive Species: Chicken, Human, Monkey, Mouse, Rat
Host: Rabbit
Application: IHC, WB
Designing a Western blot for FABP1? The guide covers the expected band size, antibodies backed by real blot images, the controls to run alongside, and protocols taken from published papers.
Open the FABP1 Western Blot Guide

Customers Who Bought This Also Bought

Product Name

Anti-liver FABP/FABP1 Antibody Picoband®

View all FABP1 Antibodies

SKU/Catalog Number

PB9586

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-liver FABP/FABP1 Antibody Picoband® catalog # PB9586. Tested in IHC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat, Chicken. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-liver FABP/FABP1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9586)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9mg NaCl, 0.2mg Na2HPO4, 0.01mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP, different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB9586 is reactive to FABP1 in Chicken, Human, Monkey, Mouse, Rat

Observed Molecular Weight

14 kDa

Calculated molecular weight

14.2 kDa

Background of FABP1

Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB9586 is guaranteed for IHC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Monkey, Mouse, Rat, Chicken
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman, Mouse, Rat

Tested application

liver antibody was positively detected by WB in:
human hepatocellular carcinoma tumor tissue (HCCT), chicken liver tissue, monkey liver tissue, rat liver tissue, rat small intestine tissue, rat RH35 whole cell, rat PC-12 whole cell, mouse liver tissue, mouse small intestine tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
liver antibody was positively detected by IHC in:
mouse intestine tissue, human intestinal cancer tissue, rat intestine tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-liver FABP/FABP1 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-liver FABP/FABP1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

7 Customer Q&As for Anti-liver FABP/FABP1 Antibody Picoband®

Question

Is this PB9586 anti-liver FABP/FABP1 antibody reactive to the isotypes of FABP1?

Verified Customer

Verified customer

Asked: 2020-02-07

Answer

The immunogen of PB9586 anti-liver FABP/FABP1 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human liver FABP (6-36aa KYQLQSQENFEAFMKAIGLPEELIQKGKDIK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-02-07

Question

Is a blocking peptide available for product anti-liver FABP/FABP1 antibody (PB9586)?

Verified Customer

Verified customer

Asked: 2019-12-27

Answer

We do provide the blocking peptide for product anti-liver FABP/FABP1 antibody (PB9586). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2019-12-27

Question

Will anti-liver FABP/FABP1 antibody PB9586 work for IHC with colon?

Verified Customer

Verified customer

Asked: 2019-08-13

Answer

According to the expression profile of colon, FABP1 is highly expressed in colon. So, it is likely that anti-liver FABP/FABP1 antibody PB9586 will work for IHC with colon.

Boster Scientific Support

Answered: 2019-08-13

Question

We are currently using anti-liver FABP/FABP1 antibody PB9586 for rat tissue, and we are content with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it true that the antibody can work on feline tissues as well?

A. Baker

Verified customer

Asked: 2019-07-25

Answer

The anti-liver FABP/FABP1 antibody (PB9586) has not been validated for cross reactivity specifically with feline tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-07-25

Question

Does PB9586 anti-liver FABP/FABP1 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

F. Miller

Verified customer

Asked: 2019-07-24

Answer

As indicated on the product datasheet, PB9586 anti-liver FABP/FABP1 antibody as been validated on IHC. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-07-24

Question

Can you help my question with product PB9586, anti-liver FABP/FABP1 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-08-01

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9586 anti-liver FABP/FABP1 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-08-01

Question

We appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for colon using anti-liver FABP/FABP1 antibody PB9586. Let me know if you need anything else.

A. Thomas

Verified customer

Asked: 2017-04-14

Answer

Thanks for the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2017-04-14

Order DetailsPrice
PB9586

100μg

$370
PB9586-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB9586-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB9586-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB9586-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB9586-APC

100 μg APC conjugated (liquid)

$820
PB9586-FITC

100 μg FITC conjugated (liquid)

$570
PB9586-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB9586-Biotin

100 μg Biotin conjugated (liquid)

$570
PB9586-HRP

100 μg HRP conjugated (liquid)

$570
PB9586-PE

100 μg PE conjugated (liquid)

$820
PB9586-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB9586
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 4, 2026