Click image to see more details
Product Info Summary
| SKU: | R00121 |
|---|---|
| Size: | 100μg/vial |
| Origin Species: | Human |
| Source: | E. Coli-derived P143-S288 |
Product info
Product Name
Recombinant Human FGF2 Protein
View all FGF2 recombinant proteins
SKU/Catalog Number
R00121
Size
100μg/vial
Description
Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging from 18-24 kDa in size due to the use of alternative start sites within the fgf-2 gene. It has a 55 percent amino acid residue identity to FGF-1 and has potent heparin-binding activity. The growth factor is an extremely potent inducer of DNA synthesis in a variety of cell types from mesoderm and neuroectoderm lineages. It was originally named basic fibroblast growth factor based upon its chemical properties and to distinguish it from acidic fibroblast growth factor. Other homologous FGF belonging to the same family are int-2 (FGF-3), FGF-5, FGF-6, K-FGF and KGF ( keratinocyte growth factor = FGF-7). All factors are products of different genes, some of which are Oncogene products ( FGF-3, FGF-4, FGF-5 ).
Storage & Handling
Lyophilized recombinant mouse Fibroblast Growth Factor basic (FGF-basic/FGF-2) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhFGF2 remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
Cite This Product
Recombinant Human FGF2 Protein (Boster Biological Technology, Pleasanton CA, USA, Catalog # R00121)
Form
Lyophilized
Formulation
Lyophilized after extensive dialysis against PBS.
Purity
>95%, by SDS-PAGE quantitative densitometry by Coomassie® Blue Staining.
Predicted MW
30.8 kDa
Endotoxin
Less than 1 EU/μg of rHubFGF as determined by LAL method.
Amino Acid Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Assay dilution & Images
Validation Images & Assay Conditions
Click image to see more details
Boster Kit Box
Specific Publications For Recombinant Human FGF2 Protein (R00121)
Loading publications
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Recombinant Human FGF2 Protein?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Recombinant Human FGF2 Protein
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
