Anti-ACAA2 Antibody Picoband™

ACAA2 antibody

Boster Bio Anti-ACAA2 Antibody Picoband™ catalog # PB10022. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB10022
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, IHC-F, ICC, WB

Product Name

Anti-ACAA2 Antibody Picoband™

View all ACAA2 Antibodies

SKU/Catalog Number

PB10022

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ACAA2 Antibody Picoband™ catalog # PB10022. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ACAA2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10022)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human ACAA2, different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB10022 is reactive to ACAA2 in Human, Mouse, Rat

Applications

PB10022 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, ICC, WB Boster Guarantee

Observed Molecular Weight

42 kDa

Calculated molecular weight

41.924kDa

Background of ACAA2

3-Ketoacyl-CoA thiolase, mitochondrial, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene. The ACAA2 gene encodes a 41.9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides. The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. Additionally, ACAA2 has been shown to be a functional BNIP3 binding partner, which provides a possible link between fatty acid metabolism and cell apoptosis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat
Immunohistochemistry (Frozen Section), 0.5-1μg/ml, Human
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For ACAA2 (Source: Uniprot.org, NCBI)

Gene Name

ACAA2

Full Name

3-ketoacyl-CoA thiolase, mitochondrial

Weight

41.924kDa

Superfamily

thiolase-like superfamily

Alternative Names

3-ketoacyl-CoA thiolase, mitochondrial; acetyl-CoA acyltransferase 2; Acetyl-CoA acyltransferase; acetyl-Coenzyme A acyltransferase 2; beta ketothiolase; beta-ketothiolase; DSAEC; EC 2.3.1; EC 2.3.1.16; FLJ35992; FLJ95265; Mitochondrial 3-oxoacyl-CoA thiolase; mitochondrial 3-oxoacyl-Coenzyme A thiolase; T1 ACAA2 DSAEC acetyl-CoA acyltransferase 2 3-ketoacyl-CoA thiolase, mitochondrial|T1|acetyl-CoA acetyltransferase|acetyl-Coenzyme A acyltransferase 2|acyl-CoA hydrolase, mitochondrial|beta ketothiolase|mitochondrial 3-oxoacyl-CoA thiolase|mitochondrial 3-oxoacyl-Coenzyme A thiolase

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ACAA2, check out the ACAA2 Infographic

ACAA2 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ACAA2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10022

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-ACAA2 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-ACAA2 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-ACAA2 Antibody Picoband™

Question

Is this PB10022 anti-ACAA2 antibody reactive to the isotypes of ACAA2?

L. Miller

Verified customer

Asked: 2019-10-23

Answer

The immunogen of PB10022 anti-ACAA2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human ACAA2 (207-242aa EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-23

Question

We are currently using anti-ACAA2 antibody PB10022 for mouse tissue, and we are content with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-20

Answer

The anti-ACAA2 antibody (PB10022) has not been validated for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-20

Question

See attached the WB image, lot number and protocol we used for cervix carcinoma using anti-ACAA2 antibody PB10022. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-25

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-25

Question

Is a blocking peptide available for product anti-ACAA2 antibody (PB10022)?

Verified Customer

Verified customer

Asked: 2018-09-21

Answer

We do provide the blocking peptide for product anti-ACAA2 antibody (PB10022). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2018-09-21

Size

Conjugation

Total: $370

SKU:PB10022

In stock, 2 left.

Order within 4 hours and 30 minutes to receive by Wed Mar 20

Get A Quote
Eddy test
In stock
Order Product
PB10022
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.