Anti-ACAA2 Antibody Picoband®

ACAA2 antibody

Boster Bio Anti-ACAA2 Antibody Picoband® catalog # PB10022. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB10022
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, IHC, IHC-F, ICC, WB
Designing a Western blot for ACAA2? The guide covers the expected band size, antibodies backed by real blot images, the controls to run alongside, and protocols taken from published papers.
Open the ACAA2 Western Blot Guide

Customers Who Bought This Also Bought

Product Name

Anti-ACAA2 Antibody Picoband®

View all ACAA2 Antibodies

SKU/Catalog Number

PB10022

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-ACAA2 Antibody Picoband® catalog # PB10022. Tested in Flow Cytometry, IF, IHC, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-ACAA2 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10022)

Host

Rabbit

Contents

Each vial contains antibody formulated with stabilizing components, 0.9 mg NaCl, 0.2 mg Na2HPO4, and 0.05 mg NaN3.
*This antibody is supplied in a stabilized formulation.
Compatibility with conjugation reactions depends on the chemistry of the conjugation method used.
For conjugation methods that are not compatible with the stabilizing components present in this formulation, a carrier-free antibody format is required.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human ACAA2, different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Cross-reactivity

No cross-reactivity with other proteins

Reactive Species

PB10022 is reactive to ACAA2 in Human, Mouse, Rat

Observed Molecular Weight

42 kDa

Calculated molecular weight

41.9 kDa

Background of ACAA2

3-Ketoacyl-CoA thiolase, mitochondrial, also known as acetyl-Coenzyme A acyltransferase 2, is an acetyl-CoA C-acyltransferase enzyme that in humans is encoded by the ACAA2 gene. The ACAA2 gene encodes a 41.9 kDa protein that is composed of 397 amino acids and contains 88 observed peptides. The encoded protein catalyzes the last step of themitochondrial fatty acid beta oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal. Additionally, ACAA2 has been shown to be a functional BNIP3 binding partner, which provides a possible link between fatty acid metabolism and cell apoptosis.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB10022 is guaranteed for Flow Cytometry, IF, IHC, IHC-F, ICC, WB Boster Guarantee

Recommend Dilution

ApplicationDilutionSpecies
Western blot0.1-0.5μg/mlHuman, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section)0.5-1μg/mlHuman
Immunohistochemistry (Frozen Section)0.5-1μg/mlHuman
Immunocytochemistry/Immunofluorescence2μg/mlHuman
Flow Cytometry (Fixed)1-3μg/1x106 cellsHuman

Tested application

ACAA2 antibody was positively detected by WB in:
rat liver tissue, rat lung tissue, rat brain tissue, rat kidney tissue, human Hela whole cell, mouse HEPA1-6 whole cell, mouse NIH/3T3 whole cell, mouse SP2/0 whole cell, mouse lung tissue
Suggested blocking solution with 5% non-fat milk or BSA; (*)Recommended protein loading: 20-40 µg per lane
ACAA2 antibody was positively detected by IHC in:
human intestinal cancer tissue
Use TE buffer pH 9.0 for antigen retrieval; (*) citrate buffer pH 6.0 is an alternative.
ACAA2 antibody was positively detected by ICC/IF in:
U20S cell
ACAA2 antibody was positively detected by FC in:
HepG2 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-ACAA2 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-ACAA2 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-ACAA2 Antibody Picoband®

Question

Is this PB10022 anti-ACAA2 antibody reactive to the isotypes of ACAA2?

L. Miller

Verified customer

Asked: 2019-10-23

Answer

The immunogen of PB10022 anti-ACAA2 antibody is A synthetic peptide corresponding to a sequence in the middle region of human ACAA2 (207-242aa EVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFKKD), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-10-23

Question

We are currently using anti-ACAA2 antibody PB10022 for mouse tissue, and we are content with the IF results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on pig tissues as well?

Verified Customer

Verified customer

Asked: 2019-08-20

Answer

The anti-ACAA2 antibody (PB10022) has not been validated for cross reactivity specifically with pig tissues, but there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in pig you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2019-08-20

Question

See attached the WB image, lot number and protocol we used for cervix carcinoma using anti-ACAA2 antibody PB10022. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-06-25

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-06-25

Question

Is a blocking peptide available for product anti-ACAA2 antibody (PB10022)?

Verified Customer

Verified customer

Asked: 2018-09-21

Answer

We do provide the blocking peptide for product anti-ACAA2 antibody (PB10022). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2018-09-21

Order DetailsPrice
PB10022

100μg

$370
PB10022-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB10022-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB10022-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB10022-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB10022-APC

100 μg APC conjugated (liquid)

$820
PB10022-FITC

100 μg FITC conjugated (liquid)

$570
PB10022-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB10022-Biotin

100 μg Biotin conjugated (liquid)

$570
PB10022-HRP

100 μg HRP conjugated (liquid)

$570
PB10022-PE

100 μg PE conjugated (liquid)

$820
PB10022-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10022
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: Sep 9, 2026