Product Info Summary
SKU: | PB10046 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Rat |
Host: | Rabbit |
Application: | WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-ACCN1/ASIC2 Antibody Picoband™
SKU/Catalog Number
PB10046
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-ACCN1/ASIC2 Antibody Picoband™ catalog # PB10046. Tested in WB applications. This antibody reacts with Human, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-ACCN1/ASIC2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10046)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1, different from the related mouse and rat sequences by one amino acid.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB10046 is reactive to ASIC2 in Human, Rat
Applications
PB10046 is guaranteed for WB Boster Guarantee
Observed Molecular Weight
65 kDa
Calculated molecular weight
57.709kDa
Background of ACCN1
Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Rat
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of ACCN1 using anti-ACCN1 antibody (PB10046).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat testis tissue lysates,
Lane 2: MCF-7 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ACCN1 antigen affinity purified polyclonal antibody (Catalog # PB10046) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for ACCN1 at approximately 65 kDa. The expected band size for ACCN1 is at 58 kDa.
Protein Target Info & Infographic
Gene/Protein Information For ASIC2 (Source: Uniprot.org, NCBI)
Gene Name
ASIC2
Full Name
Acid-sensing ion channel 2
Weight
57.709kDa
Superfamily
amiloride-sensitive sodium channel (TC 1.A.6) family
Alternative Names
Acid-sensing ion channel 2; Amiloride-sensitive brain sodium channel; amiloride-sensitive cation channel 1, neuronal; ASIC2a; ASIC2Mammalian degenerin homolog; BNAC1; BNaC1ACCN; BNC1Amiloride-sensitive cation channel neuronal 1; degenerin; hBNaC1; MDEGBrain sodium channel 1; neuronal amiloride-sensitive cation channel 1 ASIC2 ACCN, ACCN1a, BNC1, BNaC1, MDEG, hBNaC1, ASIC2 acid sensing ion channel subunit 2 acid-sensing ion channel 2|acid sensing (proton gated) ion channel 2|amiloride-sensitive cation channel 1, neuronal|brain sodium channel 1|mammalian degenerin homolog|neuronal amiloride-sensitive cation channel 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ASIC2, check out the ASIC2 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ASIC2: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-ACCN1/ASIC2 Antibody Picoband™ (PB10046)
Hello CJ!
No publications found for PB10046
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-ACCN1/ASIC2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-ACCN1/ASIC2 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
7 Customer Q&As for Anti-ACCN1/ASIC2 Antibody Picoband™
Question
Will PB10046 anti-ACCN1/ASIC2 antibody work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?
N. Jha
Verified customer
Asked: 2019-10-18
Answer
It shows on the product datasheet, PB10046 anti-ACCN1/ASIC2 antibody as been validated on WB. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.
Boster Scientific Support
Answered: 2019-10-18
Question
Is this PB10046 anti-ACCN1/ASIC2 antibody reactive to the isotypes of ASIC2?
Verified Customer
Verified customer
Asked: 2019-01-02
Answer
The immunogen of PB10046 anti-ACCN1/ASIC2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK), different from the related mouse and rat sequences by one amino acid. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-01-02
Question
Would anti-ACCN1/ASIC2 antibody PB10046 work on monkey WB with brain?
P. Baker
Verified customer
Asked: 2018-01-26
Answer
Our lab technicians have not tested anti-ACCN1/ASIC2 antibody PB10046 on monkey. You can run a BLAST between monkey and the immunogen sequence of anti-ACCN1/ASIC2 antibody PB10046 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated monkey samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in monkey brain in WB, you can get your next antibody for free.
Boster Scientific Support
Answered: 2018-01-26
Question
Is a blocking peptide available for product anti-ACCN1/ASIC2 antibody (PB10046)?
Verified Customer
Verified customer
Asked: 2017-07-27
Answer
We do provide the blocking peptide for product anti-ACCN1/ASIC2 antibody (PB10046). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2017-07-27
Question
We are currently using anti-ACCN1/ASIC2 antibody PB10046 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, rat. Is it possible that the antibody can work on feline tissues as well?
Verified Customer
Verified customer
Asked: 2017-05-12
Answer
The anti-ACCN1/ASIC2 antibody (PB10046) has not been validated for cross reactivity specifically with feline tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in feline you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2017-05-12
Question
I was wanting to use your anti-ACCN1/ASIC2 antibody for WB for human frontal cortex on frozen tissues, but I want to know if it has been validated for this particular application. Has this antibody been validated and is this antibody a good choice for human frontal cortex identification?
A. Patel
Verified customer
Asked: 2016-08-01
Answer
As indicated on the product datasheet, PB10046 anti-ACCN1/ASIC2 antibody has been tested for WB on human, rat tissues. We have an innovator award program that if you test this antibody and show it works in human frontal cortex in IHC-frozen, you can get your next antibody for free.
Boster Scientific Support
Answered: 2016-08-01
Question
Can you help my question with product PB10046, anti-ACCN1/ASIC2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
K. Krishna
Verified customer
Asked: 2014-06-06
Answer
We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB10046 anti-ACCN1/ASIC2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2014-06-06