Product Info Summary
SKU: | PB10033 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-Adenylate Kinase 1/AK1 Antibody Picoband™
View all Adenylate Kinase 1 Antibodies
SKU/Catalog Number
PB10033
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-Adenylate Kinase 1/AK1 Antibody Picoband™ catalog # PB10033. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-Adenylate Kinase 1/AK1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10033)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Adenylate Kinase 1, different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB10033 is reactive to AK1 in Human, Mouse, Rat
Applications
PB10033 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee
Observed Molecular Weight
22 kDa
Calculated molecular weight
21.635kDa
Background of Adenylate Kinase 1
This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of Adenylate Kinase 1 using anti-Adenylate Kinase 1 antibody (PB10033).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.
Lane 1: rat skeletal muscle tissue lysates,
Lane 2: mouse cardiac muscle tissue lysates.
Lane 3: COLO320 whole cell lysates.
After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Adenylate Kinase 1 antigen affinity purified polyclonal antibody (Catalog # PB10033) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:5000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Adenylate Kinase 1 at approximately 22 kDa. The expected band size for Adenylate Kinase 1 is at 22 kDa.
Click image to see more details
Figure 2. IF analysis of Adenylate Kinase 1 using anti-Adenylate Kinase 1 antibody (PB10033).
Adenylate Kinase 1 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-Adenylate Kinase 1 Antibody (PB10033) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 3. Flow Cytometry analysis of A431 cells using anti-Adenylate Kinase 1 antibody (PB10033).
Overlay histogram showing A431 cells stained with PB10033 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Adenylate Kinase 1 Antibody (PB10033,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For AK1 (Source: Uniprot.org, NCBI)
Gene Name
AK1
Full Name
Adenylate kinase isoenzyme 1
Weight
21.635kDa
Superfamily
adenylate kinase family
Alternative Names
adenylate kinase 1; adenylate kinase isoenzyme 1; AK 1; ATP-AMP transphosphorylase 1; EC 2.7.4; EC 2.7.4.3; myokinase AK1 HTL-S-58j adenylate kinase 1 adenylate kinase isoenzyme 1|ATP-AMP transphosphorylase 1|ATP:AMP phosphotransferase|adenylate monophosphate kinase|epididymis secretory sperm binding protein|myokinase|testis secretory sperm binding protein Li 58j
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on AK1, check out the AK1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for AK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-Adenylate Kinase 1/AK1 Antibody Picoband™ (PB10033)
Hello CJ!
No publications found for PB10033
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-Adenylate Kinase 1/AK1 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
0 Reviews For Anti-Adenylate Kinase 1/AK1 Antibody Picoband™
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-Adenylate Kinase 1/AK1 Antibody Picoband™
Question
Is this PB10033 anti-Adenylate Kinase 1/AK1 antibody reactive to the isotypes of AK1?
Verified Customer
Verified customer
Asked: 2020-04-29
Answer
The immunogen of PB10033 anti-Adenylate Kinase 1/AK1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2020-04-29
Question
Is a blocking peptide available for product anti-Adenylate Kinase 1/AK1 antibody (PB10033)?
Verified Customer
Verified customer
Asked: 2020-02-17
Answer
We do provide the blocking peptide for product anti-Adenylate Kinase 1/AK1 antibody (PB10033). If you would like to place an order for it please contact [email protected] and make a special request.
Boster Scientific Support
Answered: 2020-02-17
Question
We are currently using anti-Adenylate Kinase 1/AK1 antibody PB10033 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?
Verified Customer
Verified customer
Asked: 2020-01-21
Answer
The anti-Adenylate Kinase 1/AK1 antibody (PB10033) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2020-01-21
Question
I have attached the WB image, lot number and protocol we used for erythroleukemia using anti-Adenylate Kinase 1/AK1 antibody PB10033. Please let me know if you require anything else.
H. Parker
Verified customer
Asked: 2016-08-10
Answer
Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.
Boster Scientific Support
Answered: 2016-08-10