Anti-Adenylate Kinase 1/AK1 Antibody Picoband®

AK1 antibody

Boster Bio Anti-Adenylate Kinase 1/AK1 Antibody Picoband® catalog # PB10033. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Product Info Summary

SKU: PB10033
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, WB

Customers Who Bought This Also Bought

Product Name

Anti-Adenylate Kinase 1/AK1 Antibody Picoband®

View all AK1 Antibodies

SKU/Catalog Number

PB10033
PB1082 is an alternative SKU for this antibody, used in previous lots.

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Adenylate Kinase 1/AK1 Antibody Picoband® catalog # PB10033. Tested in Flow Cytometry, IHC, WB applications. This antibody reacts with Human, Mouse, Rat. The brand Picoband indicates this is a premium antibody that guarantees superior quality, high affinity, and strong signals with minimal background in Western blot applications. Only our best-performing antibodies are designated as Picoband, ensuring unmatched performance.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Adenylate Kinase 1/AK1 Antibody Picoband® (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10033)

Host

Rabbit

Contents

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Adenylate Kinase 1, different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB10033 is reactive to AK1 in Human, Mouse, Rat

Observed Molecular Weight

22 kDa

Calculated molecular weight

21.6 kDa

Background of AK1

This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Applications

PB10033 is guaranteed for Flow Cytometry, IHC, WB Boster Guarantee

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry(Paraffin-embedded Section), 2-5μg/ml, Human, Mouse, Rat
Flow Cytometry (Fixed), 1-3μg/1x106 cells, Human

Positive Control

WB: human Hela whole cell lysates, human SiHa whole cell lysates, rat heart tissue lysates, mouse lung tissue lysates, mouse heart tissue lysates
IHC: human colon cancer tissue, human lung adenocarcinoma tissue, mouse heart tissue, rat heart tissue
FCM: PC-3 cell

Validation Images & Assay Conditions

Loading publications

No publications found

Do you have publications using this product? Share with us and receive a reward. Contact us for more information.

Publications not available. Please try again later.

Product has been cited in publications

No results found matching your query

  • Published: --- Journal: --- Application: --- Impact Factor: --- Species: --- PMID: --- View Article

Have you used Anti-Adenylate Kinase 1/AK1 Antibody Picoband®?

Share your experimental results or join a short interview to earn up to $1,000 in product credits or other rewards.

0 Reviews For Anti-Adenylate Kinase 1/AK1 Antibody Picoband®

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Adenylate Kinase 1/AK1 Antibody Picoband®

Question

Is this PB10033 anti-Adenylate Kinase 1/AK1 antibody reactive to the isotypes of AK1?

Verified Customer

Verified customer

Asked: 2020-04-29

Answer

The immunogen of PB10033 anti-Adenylate Kinase 1/AK1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-29

Question

Is a blocking peptide available for product anti-Adenylate Kinase 1/AK1 antibody (PB10033)?

Verified Customer

Verified customer

Asked: 2020-02-17

Answer

We do provide the blocking peptide for product anti-Adenylate Kinase 1/AK1 antibody (PB10033). If you would like to place an order for it please contact support@bosterbio.com and make a special request.

Boster Scientific Support

Answered: 2020-02-17

Question

We are currently using anti-Adenylate Kinase 1/AK1 antibody PB10033 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-21

Answer

The anti-Adenylate Kinase 1/AK1 antibody (PB10033) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-21

Question

I have attached the WB image, lot number and protocol we used for erythroleukemia using anti-Adenylate Kinase 1/AK1 antibody PB10033. Please let me know if you require anything else.

H. Parker

Verified customer

Asked: 2016-08-10

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-08-10

Order DetailsPrice
PB10033

100μg

$370
PB10033-Fluoro488

100 μg Fluoro488 conjugated (liquid)

$570
PB10033-Fluoro550

100 μg Fluoro550 conjugated (liquid)

$570
PB10033-Fluoro594

100 μg Fluoro594 conjugated (liquid)

$570
PB10033-Fluoro647

100 μg Fluoro647 conjugated (liquid)

$670
PB10033-APC

100 μg APC conjugated (liquid)

$820
PB10033-FITC

100 μg FITC conjugated (liquid)

$570
PB10033-Cy3

100 μg Cy3 conjugated (liquid)

$570
PB10033-Biotin

100 μg Biotin conjugated (liquid)

$570
PB10033-HRP

100 μg HRP conjugated (liquid)

$570
PB10033-PE

100 μg PE conjugated (liquid)

$820
PB10033-carrier-free

Carrier Free

$370
Rainbow Button View conjugates

Free Secondary Antibody

FREE  $95.00
FREE  $95.00
$40.00  $80.00
$65.00  $130.00
$67.50  $135.00
$75.00  $150.00
$30.00  $60.00
$75.00  $150.00
$55.00  $110.00
Choose an option to show lead time.
Get A Quote
In stock
Order Product
PB10033
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.

This product is for Research Use Only. Not for use in diagnostic procedures.

Update date: May 2, 2026