Anti-Adenylate Kinase 1/AK1 Antibody Picoband™

Adenylate Kinase 1 antibody

Boster Bio Anti-Adenylate Kinase 1/AK1 Antibody Picoband™ catalog # PB10033. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: PB10033
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IF, ICC, WB

Product Name

Anti-Adenylate Kinase 1/AK1 Antibody Picoband™

View all Adenylate Kinase 1 Antibodies

SKU/Catalog Number

PB10033

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-Adenylate Kinase 1/AK1 Antibody Picoband™ catalog # PB10033. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-Adenylate Kinase 1/AK1 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB10033)

Host

Rabbit

Contents

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Adenylate Kinase 1, different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

PB10033 is reactive to AK1 in Human, Mouse, Rat

Applications

PB10033 is guaranteed for Flow Cytometry, IF, ICC, WB Boster Guarantee

Observed Molecular Weight

22 kDa

Calculated molecular weight

21.635kDa

Background of Adenylate Kinase 1

This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human

Validation Images & Assay Conditions

Gene/Protein Information For AK1 (Source: Uniprot.org, NCBI)

Gene Name

AK1

Full Name

Adenylate kinase isoenzyme 1

Weight

21.635kDa

Superfamily

adenylate kinase family

Alternative Names

adenylate kinase 1; adenylate kinase isoenzyme 1; AK 1; ATP-AMP transphosphorylase 1; EC 2.7.4; EC 2.7.4.3; myokinase AK1 HTL-S-58j adenylate kinase 1 adenylate kinase isoenzyme 1|ATP-AMP transphosphorylase 1|ATP:AMP phosphotransferase|adenylate monophosphate kinase|epididymis secretory sperm binding protein|myokinase|testis secretory sperm binding protein Li 58j

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on AK1, check out the AK1 Infographic

AK1 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for AK1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for PB10033

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Adenylate Kinase 1/AK1 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image
  • $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit A Review

Be the first to review Anti-Adenylate Kinase 1/AK1 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

4 Customer Q&As for Anti-Adenylate Kinase 1/AK1 Antibody Picoband™

Question

Is this PB10033 anti-Adenylate Kinase 1/AK1 antibody reactive to the isotypes of AK1?

Verified Customer

Verified customer

Asked: 2020-04-29

Answer

The immunogen of PB10033 anti-Adenylate Kinase 1/AK1 antibody is A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2020-04-29

Question

Is a blocking peptide available for product anti-Adenylate Kinase 1/AK1 antibody (PB10033)?

Verified Customer

Verified customer

Asked: 2020-02-17

Answer

We do provide the blocking peptide for product anti-Adenylate Kinase 1/AK1 antibody (PB10033). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2020-02-17

Question

We are currently using anti-Adenylate Kinase 1/AK1 antibody PB10033 for rat tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on dog tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-21

Answer

The anti-Adenylate Kinase 1/AK1 antibody (PB10033) has not been validated for cross reactivity specifically with dog tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in dog you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-21

Question

I have attached the WB image, lot number and protocol we used for erythroleukemia using anti-Adenylate Kinase 1/AK1 antibody PB10033. Please let me know if you require anything else.

H. Parker

Verified customer

Asked: 2016-08-10

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2016-08-10

Size

Conjugation

Total: $370

SKU:PB10033

In stock, 2 left.

Order within 3 hours and 45 minutes to receive by Wed Mar 20

Get A Quote
Eddy test
In stock
Order Product
PB10033
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

$50 fee for conjugation. Antibody size is reduced to 50ug.

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.